DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scamp and Scamp5

DIOPT Version :9

Sequence 1:NP_001259572.1 Gene:Scamp / 32470 FlyBaseID:FBgn0040285 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_113914.2 Gene:Scamp5 / 65171 RGDID:68356 Length:235 Species:Rattus norvegicus


Alignment Length:219 Identity:100/219 - (45%)
Similarity:136/219 - (62%) Gaps:7/219 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 QLNNWPPLPDNFCVKPCFYQDFEVEIPPEFQKLVKRLYYIWIFYTMTLLANVIGGLILLFHAGEF 187
            ::||:||||....:|||||||||.:|||:...|.|||||:|:..::||..|::|.|..|...|..
  Rat     4 KVNNFPPLPKFIPLKPCFYQDFEADIPPQHLSLTKRLYYLWMLNSVTLAVNLVGCLAWLIGGGGA 68

  Fly   188 ETFFLAIFYTMLFSPASYVCWFRPAYKAFRNDSSFNFMVFFFIYFFQTLYSIVQAVGFNKMGYCG 252
            ..|.||..:.:||:|.||||||||.||||:.||||:||.|||.:..|.:.||:||||....|.||
  Rat    69 TNFGLAFLWLILFTPCSYVCWFRPIYKAFKTDSSFSFMAFFFTFMAQLVISIIQAVGIPGWGVCG 133

  Fly   253 FITAIGQFDGQASGIIVG--ILLLNVAFCFTAVAVANVLMITKIHSIYRSTGASMAKAQAEFTTE 315
            :|..|..|     |..:|  :::|.....||.|||.:.:.::.:|..||.:|.|.:|||.|:||.
  Rat   134 WIATISFF-----GTNIGSAVVMLIPTVMFTVVAVFSFIALSMVHKFYRGSGGSFSKAQEEWTTG 193

  Fly   316 FLRNQHVQEAASSAVNTAINSQFN 339
            ..:|.|||:||.:|...|.....|
  Rat   194 AWKNPHVQQAAQNAAMGAAQGAMN 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScampNP_001259572.1 SCAMP 125..301 CDD:282056 83/177 (47%)
Scamp5NP_113914.2 SCAMP 6..179 CDD:398011 83/177 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334773
Domainoid 1 1.000 185 1.000 Domainoid score I3290
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000703
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X309
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.