DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scamp and Scamp4

DIOPT Version :9

Sequence 1:NP_001259572.1 Gene:Scamp / 32470 FlyBaseID:FBgn0040285 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_113913.2 Gene:Scamp4 / 65170 RGDID:68354 Length:230 Species:Rattus norvegicus


Alignment Length:216 Identity:101/216 - (46%)
Similarity:134/216 - (62%) Gaps:14/216 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 NNWPPLPDNFCVKPCFYQDFEVEIPPEFQKLVKRLYYIWIFYTMTLLANVIGGLILLFHAGEFET 189
            ||:||||....:||||||||..|||.|.|.||||:|.:|:||..||..|::..|......|....
  Rat     6 NNFPPLPHFLPLKPCFYQDFSDEIPVEHQVLVKRIYRLWMFYCTTLGVNLVACLAWWIAGGAGAN 70

  Fly   190 FFLAIFYTMLFSPASYVCWFRPAYKAFRNDSSFNFMVFFFIYFFQTLYSIVQAVGFNKMGYCGFI 254
            |.||:.:.:||:|.||||||||||||||.|||||||.||||:..|.:.:::||:||:..|.||::
  Rat    71 FGLAMLWLVLFTPCSYVCWFRPAYKAFRADSSFNFMAFFFIFGAQFVLTVIQAIGFSGWGACGWL 135

  Fly   255 TAIGQFDGQASGIIVGILLLNVAFCFTAVAVANVLMITKIHSIYRSTGASMAKAQAEFTTEFLRN 319
            ..|| |.|.:.|..|.:|:..:.|..:||.:|  :.|.|:|.|||..|.|:.|||.|::....||
  Rat   136 ATIG-FFGTSVGAAVVMLIPAIMFSLSAVVMA--ITIVKVHRIYRGAGGSLQKAQTEWSAGTWRN 197

  Fly   320 QHVQEAASSAVNTAINSQFNN 340
            ...:||           |||:
  Rat   198 PPSREA-----------QFNS 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScampNP_001259572.1 SCAMP 125..301 CDD:282056 88/175 (50%)
Scamp4NP_113913.2 SCAMP 5..179 CDD:398011 88/175 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..230 6/22 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334771
Domainoid 1 1.000 185 1.000 Domainoid score I3290
eggNOG 1 0.900 - - E1_KOG3088
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D544579at33208
OrthoFinder 1 1.000 - - FOG0000703
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X309
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.710

Return to query results.
Submit another query.