DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scamp and Scamp5

DIOPT Version :9

Sequence 1:NP_001259572.1 Gene:Scamp / 32470 FlyBaseID:FBgn0040285 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_030100335.1 Gene:Scamp5 / 56807 MGIID:1928948 Length:296 Species:Mus musculus


Alignment Length:318 Identity:97/318 - (30%)
Similarity:134/318 - (42%) Gaps:99/318 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 SQNIPPPQTS---SLGASAPSTSIQI------------------------TSEELQRRQEELDRK 106
            |.::|||..|   |..:|:||.|:.:                        ..|.:          
Mouse    13 SLSLPPPSPSPSLSPPSSSPSLSLSLCLHLCMYVHICPYLAACLCLCHVFVCESI---------- 67

  Fly   107 AAELDRREQQLQGNVPQLNNWPPLPDNFCVKPCFYQDFEVEIPPEFQKLVKRLYYIWIF------ 165
                                |.|    :||.||.  |..|.           ||.:|..      
Mouse    68 --------------------WNP----WCVSPCL--DTHVS-----------LYGLWCLCVYLVS 95

  Fly   166 ------------YTMTLLANVIGGLILLFHAGEFETFFLAIFYTMLFSPASYVCWFRPAYKAFRN 218
                        .::||..|::|.|..|...|....|.||..:.:||:|.||||||||.||||:.
Mouse    96 ISVCACAPGSAVNSVTLAVNLVGCLAWLIGGGGATNFGLAFLWLILFTPCSYVCWFRPIYKAFKT 160

  Fly   219 DSSFNFMVFFFIYFFQTLYSIVQAVGFNKMGYCGFITAIGQFDGQASGIIVG--ILLLNVAFCFT 281
            ||||:||.|||.:..|.:.||:||||....|.||:|..|..|     |..:|  :::|.....||
Mouse   161 DSSFSFMAFFFTFMAQLVISIIQAVGIPGWGVCGWIATISFF-----GTNIGSAVVMLIPTVMFT 220

  Fly   282 AVAVANVLMITKIHSIYRSTGASMAKAQAEFTTEFLRNQHVQEAASSAVNTAINSQFN 339
            .|||.:.:.::.:|..||.:|.|.:|||.|:||...:|.|||:||.:|...|.....|
Mouse   221 VVAVFSFIALSMVHKFYRGSGGSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAAQGAMN 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScampNP_001259572.1 SCAMP 125..301 CDD:282056 69/195 (35%)
Scamp5XP_030100335.1 SCAMP <107..240 CDD:367838 58/137 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831058
Domainoid 1 1.000 185 1.000 Domainoid score I3367
eggNOG 1 0.900 - - E1_KOG3088
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D544579at33208
OrthoFinder 1 1.000 - - FOG0000703
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X309
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.710

Return to query results.
Submit another query.