DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scamp and scamp5.1

DIOPT Version :9

Sequence 1:NP_001259572.1 Gene:Scamp / 32470 FlyBaseID:FBgn0040285 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001007955.1 Gene:scamp5.1 / 493330 XenbaseID:XB-GENE-22061154 Length:229 Species:Xenopus tropicalis


Alignment Length:221 Identity:104/221 - (47%)
Similarity:141/221 - (63%) Gaps:9/221 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 NNWPPLPDNFCVKPCFYQDFEVEIPPEFQKLVKRLYYIWIFYTMTLLANVIGGLILLFHAGEFET 189
            ||:||||....:||||:||||.:||...:...||||.:|:..::||..|:||.|..:...|....
 Frog     6 NNFPPLPRFIPLKPCFHQDFENDIPDLHRTTCKRLYSLWMLNSITLGVNLIGCLAWMIGGGGAIN 70

  Fly   190 FFLAIFYTMLFSPASYVCWFRPAYKAFRNDSSFNFMVFFFIYFFQTLYSIVQAVGFNKMGYCGFI 254
            |.|||.:.:||:|.|||||||||||||:.|||||||.|||.:..|.:.||:||||....|.||:|
 Frog    71 FGLAILWVILFTPCSYVCWFRPAYKAFKTDSSFNFMAFFFTFSAQLVISIIQAVGIPGWGVCGWI 135

  Fly   255 TAIGQFDGQASGIIVG--ILLLNVAFCFTAVAVANVLMITKIHSIYRSTGASMAKAQAEFTTEFL 317
            ..:|.|     |..||  :::|.....||||||.:.:.:||:|..||..|.|::|||.|:||...
 Frog   136 ATVGFF-----GTSVGAAVVMLFPTILFTAVAVLSFVALTKVHRFYRGAGGSLSKAQEEWTTGAW 195

  Fly   318 RNQHVQEAASSAVNTAINSQFNNSRY 343
            :|.|||:||.:|...|::  .|:.:|
 Frog   196 KNPHVQQAAQNAAQGAMS--HNDPQY 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScampNP_001259572.1 SCAMP 125..301 CDD:282056 86/177 (49%)
scamp5.1NP_001007955.1 SCAMP 5..179 CDD:398011 86/177 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D544579at33208
OrthoFinder 1 1.000 - - FOG0000703
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X309
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.