DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scamp and Clk2

DIOPT Version :10

Sequence 1:NP_573023.2 Gene:Scamp / 32470 FlyBaseID:FBgn0040285 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_008759408.1 Gene:Clk2 / 365842 RGDID:1359711 Length:540 Species:Rattus norvegicus


Alignment Length:72 Identity:17/72 - (23%)
Similarity:31/72 - (43%) Gaps:20/72 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SGLDENPFGEPNLDNPFADPAIQQARRLQSGA--ALVSLEDYNPFEEQAKPQLQINSTNTAAVVQ 66
            |.|.|..||.          .:|.....:.||  ||..:::...::|.|:  |:||      |::
  Rat   207 STLGEGTFGR----------VVQCVDHRRGGARVALKIIKNVEKYKEAAR--LEIN------VLE 253

  Fly    67 PLSQNIP 73
            .:::..|
  Rat   254 KINEKDP 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScampNP_573023.2 SCAMP 125..301 CDD:461193
Clk2XP_008759408.1 PKc_CLK2 190..519 CDD:271117 17/72 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.