DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scamp and SCAMP4

DIOPT Version :9

Sequence 1:NP_001259572.1 Gene:Scamp / 32470 FlyBaseID:FBgn0040285 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_524558.1 Gene:SCAMP4 / 113178 HGNCID:30385 Length:229 Species:Homo sapiens


Alignment Length:216 Identity:101/216 - (46%)
Similarity:130/216 - (60%) Gaps:14/216 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 NNWPPLPDNFCVKPCFYQDFEVEIPPEFQKLVKRLYYIWIFYTMTLLANVIGGLILLFHAGEFET 189
            ||:||||....|||||||:|..|||.|.|.||||:|.:|:||..||..|:|..|......|....
Human     6 NNFPPLPKFIPVKPCFYQNFSDEIPVEHQVLVKRIYRLWMFYCATLGVNLIACLAWWIGGGSGTN 70

  Fly   190 FFLAIFYTMLFSPASYVCWFRPAYKAFRNDSSFNFMVFFFIYFFQTLYSIVQAVGFNKMGYCGFI 254
            |.||..:.:||:|..|||||||.|||||.|||||||.||||:..|.:.:::||:||:..|.||::
Human    71 FGLAFVWLLLFTPCGYVCWFRPVYKAFRADSSFNFMAFFFIFGAQFVLTVIQAIGFSGWGACGWL 135

  Fly   255 TAIGQFDGQASGIIVGILLLNVAFCFTAVAVANVLMITKIHSIYRSTGASMAKAQAEFTTEFLRN 319
            :|||.|. .:.|..|.:||..:.|..:|..:|  :.|.|:|.|||..|.|..|||.|:.|...||
Human   136 SAIGFFQ-YSPGAAVVMLLPAIMFSVSAAMMA--IAIMKVHRIYRGAGGSFQKAQTEWNTGTWRN 197

  Fly   320 QHVQEAASSAVNTAINSQFNN 340
            ...:||           |:||
Human   198 PPSREA-----------QYNN 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScampNP_001259572.1 SCAMP 125..301 CDD:282056 87/175 (50%)
SCAMP4NP_524558.1 SCAMP 5..178 CDD:309320 86/174 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..229 101/216 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141105
Domainoid 1 1.000 185 1.000 Domainoid score I3381
eggNOG 1 0.900 - - E1_KOG3088
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000703
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X309
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.700

Return to query results.
Submit another query.