DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cngl and CNGC12

DIOPT Version :9

Sequence 1:NP_001245691.1 Gene:Cngl / 32468 FlyBaseID:FBgn0263257 Length:1970 Species:Drosophila melanogaster
Sequence 2:NP_001324486.1 Gene:CNGC12 / 819253 AraportID:AT2G46450 Length:649 Species:Arabidopsis thaliana


Alignment Length:543 Identity:111/543 - (20%)
Similarity:202/543 - (37%) Gaps:132/543 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 KSVK-RRRRYLQKRRSVVNPDENFYFYWLMMLTVCVLYNLWTLIVRQSFP-ELQQSVPTFWLICD 281
            |||: |.::...|.:::.|..:......::.|.:..|:....||..|.|. ...:::.....:..
plant    21 KSVRGRLKKVYGKMKTLENWRKTVLLACVVALAIDPLFLFIPLIDSQRFCFTFDKTLVAVVCVIR 85

  Fly   282 SMTDVVFILDIIVQLRTGYLE-------QGLMVYDDRKLACHYVHSR---------DFIFDMIAL 330
            :..|..:::.||..|.|..:.       :|.:|          |||:         .||.|:|::
plant    86 TFIDTFYVIHIIYYLITETIAPRSQASLRGEIV----------VHSKATLKTRLLFHFIVDIISV 140

  Fly   331 IP------LDLLQLKMG------------THPLLRFTRFFKVYRSV--RFYYIVESRTVWPNLWR 375
            :|      |.|:.|...            :..:.|..|.:.:|:.|  .|..:.||:  |..  .
plant   141 LPIPQVVVLTLIPLSASLVSERILKWIILSQYVPRIIRMYPLYKEVTRAFGTVAESK--WAG--A 201

  Fly   376 VVNLIHILLILAHWFGCFYFLLSEAEGFQGDW--------------------------------- 407
            .:||. :.::.::.||.|:: ||..|.....|                                 
plant   202 ALNLF-LYMLHSYVFGAFWY-LSSIERKSKCWRAACARTSDCNLTVTDLLCKRAGSDNIRFLNTS 264

  Fly   408 ---------------------------VYPYRPGDYATLTRKYLGSLYWSTLTLTTIG-DLPTPE 444
                                       |...:|.|:   .||::...:|....::.:| :|.|..
plant   265 CPLIDPAQITNSTDFDFGMYIDALKSGVLEVKPKDF---PRKFVYCFWWGLRNISALGQNLETSN 326

  Fly   445 TNAEYIFTIVSYLIGVFIFATIVGQVGNVITNRNANRLEFERLLDGAKTYMRHHKVPGGMKRRVL 509
            :..|..|.|:..:.|:.:||.::|.|...:.:......|.|......:.:|.:..:|..:|.|:.
plant   327 SAGEIFFAIIICVSGLLLFAVLIGNVQKYLQSSTTRVDEMEEKRRDTEKWMSYRVIPEYLKERIR 391

  Fly   510 RWYDYSWSRGRIQGGGDINTALGLLPDKLKTELALHVNLSVLKKVTIFQECQPEFLHDLVL-KMK 573
            |:.||.|   |...|.:....|..||..|:.|...::.|.:||:|.........:|.:.|. ::|
plant   392 RFEDYKW---RETKGTEEEALLRSLPKDLRLETKRYLYLDMLKRVPWLNIMDDGWLLEAVCDRVK 453

  Fly   574 AYIFTPGDSICRKGEVAREMFIIADGILEVLSETG-------KVLTTMKAGDFFGEIGILNLDGL 631
            :..:.....|.|:|....||.|:..|.|:  |.||       .....::.||..||: :.|...|
plant   454 SVFYLANSFIVREGHPVEEMLIVTRGKLK--STTGSHEMGVRNNCCDLQDGDICGEL-LFNGSRL 515

  Fly   632 NKRTADVRSVGYSELFSLSREDV 654
            ...|..|.::...|.|.|..:|:
plant   516 PTSTRTVMTLTEVEGFILLPDDI 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CnglNP_001245691.1 Ion_trans 260..481 CDD:278921 56/318 (18%)
Ion_trans_2 382..476 CDD:285168 24/154 (16%)
Crp 550..>680 CDD:223736 29/113 (26%)
CAP_ED 556..668 CDD:237999 26/107 (24%)
CNGC12NP_001324486.1 Ion_trans <302..362 CDD:395416 14/59 (24%)
CAP_ED 435..560 CDD:237999 26/107 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1073751at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.