DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9164 and GCNT3

DIOPT Version :9

Sequence 1:NP_573021.1 Gene:CG9164 / 32467 FlyBaseID:FBgn0030634 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_004742.1 Gene:GCNT3 / 9245 HGNCID:4205 Length:438 Species:Homo sapiens


Alignment Length:290 Identity:61/290 - (21%)
Similarity:104/290 - (35%) Gaps:92/290 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VLFLSMNNIPGSHPKRP----------------RIER-FAEFP-SFHSPRFPMPSRKMTI----- 63
            ||...:||:.....:.|                :.|| |.:|| |.....||: :..|.|     
Human    81 VLQAILNNLEVKKKREPFTDTHYLSLTRDCEHFKAERKFIQFPLSKEEVEFPI-AYSMVIHEKIE 144

  Fly    64 RWCRDLKYINRDLPIY---ADYKSDFYTALPSDVSAALQSLPALTALASFPGSGNTWLRYLLQQA 125
            .:.|.|:.:.....||   .|.||      |.....|::::     ::.||   |.::...|.:.
Human   145 NFERLLRAVYAPQNIYCVHVDEKS------PETFKEAVKAI-----ISCFP---NVFIASKLVRV 195

  Fly   126 TGILTGSIYKDYG----LLKTGFPAE---NVCNSSVLLVKTHEWGSKAWAPFSKAILLVRDPEKA 183
            .......:..|..    ||::..|.:   |.|.:        ::..|:.|...:|:.::      
Human   196 VYASWSRVQADLNCMEDLLQSSVPWKYFLNTCGT--------DFPIKSNAEMVQALKML------ 246

  Fly   184 IIAEFNRQSGGHIGFAS--PDRYKRTKGKYWQQFV------SNKLKGWEMMNLSWARNFTGSIKV 240
                     .|.....|  |.::|.|:.||..:.|      :||.|.....||:.   |||:..:
Human   247 ---------NGRNSMESEVPPKHKETRWKYHFEVVRDTLHLTNKKKDPPPYNLTM---FTGNAYI 299

  Fly   241 VFYDDLVHHTERELRSILDFLQFPINEQLM 270
            |...|.|.|.          |:.|.::||:
Human   300 VASRDFVQHV----------LKNPKSQQLI 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9164NP_573021.1 Sulfotransfer_1 107..>271 CDD:304426 37/179 (21%)
GCNT3NP_004742.1 Branch 133..401 CDD:308216 48/238 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156644
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.