DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9164 and WSC2

DIOPT Version :10

Sequence 1:NP_573021.1 Gene:CG9164 / 32467 FlyBaseID:FBgn0030634 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_014116.1 Gene:WSC2 / 855438 SGDID:S000005227 Length:503 Species:Saccharomyces cerevisiae


Alignment Length:72 Identity:17/72 - (23%)
Similarity:31/72 - (43%) Gaps:6/72 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 DLKYINRDLPIYADYKSDFYTALPSDVSAALQSLPALTALASFPGSGNTWLRY-LLQQATG---- 127
            ||:...:..| |:...:|....:|...|:....:|:....|....:.:|:..| |..:|.|    
Yeast   358 DLEETKQYQP-YSLGDADANPVIPPSASSTNWHIPSRNNTALSKNTASTFATYDLPTRAPGGRDS 421

  Fly   128 ILTGSIY 134
            |:||..:
Yeast   422 IITGDAH 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9164NP_573021.1 Sulfotransfer_3 <174..261 CDD:480665
WSC2NP_014116.1 WSC 25..118 CDD:214616
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.