DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9164 and Kremen1

DIOPT Version :9

Sequence 1:NP_573021.1 Gene:CG9164 / 32467 FlyBaseID:FBgn0030634 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_115772.2 Gene:Kremen1 / 84035 MGIID:1933988 Length:473 Species:Mus musculus


Alignment Length:65 Identity:12/65 - (18%)
Similarity:26/65 - (40%) Gaps:20/65 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LQGWRFFGVSATIIIYIGGVLFLSMNNIPGSHPKRPRIERFAEFPSFHSPRFPMPSRKMTIRWCR 67
            ::||..:|::..:|:.:..|:...:.::                 :|.|.|.|...   .:|.||
Mouse   388 VEGWTVYGLATLLILTVTAVVAKILLHV-----------------TFKSHRVPASG---DLRDCR 432

  Fly    68  67
            Mouse   433  432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9164NP_573021.1 Sulfotransfer_1 107..>271 CDD:304426
Kremen1NP_115772.2 KR 31..114 CDD:238056
WSC 119..200 CDD:280068
CUB 214..320 CDD:238001
Essential for apoptotic activity. /evidence=ECO:0000269|PubMed:26206087 414..473 7/39 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.