powered by:
Protein Alignment CG9164 and Kremen1
DIOPT Version :9
Sequence 1: | NP_573021.1 |
Gene: | CG9164 / 32467 |
FlyBaseID: | FBgn0030634 |
Length: | 317 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_115772.2 |
Gene: | Kremen1 / 84035 |
MGIID: | 1933988 |
Length: | 473 |
Species: | Mus musculus |
Alignment Length: | 65 |
Identity: | 12/65 - (18%) |
Similarity: | 26/65 - (40%) |
Gaps: | 20/65 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 LQGWRFFGVSATIIIYIGGVLFLSMNNIPGSHPKRPRIERFAEFPSFHSPRFPMPSRKMTIRWCR 67
::||..:|::..:|:.:..|:...:.:: :|.|.|.|... .:|.||
Mouse 388 VEGWTVYGLATLLILTVTAVVAKILLHV-----------------TFKSHRVPASG---DLRDCR 432
Fly 68 67
Mouse 433 432
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4157 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.