powered by:
Protein Alignment CG9164 and gcnt4b.1
DIOPT Version :9
Sequence 1: | NP_573021.1 |
Gene: | CG9164 / 32467 |
FlyBaseID: | FBgn0030634 |
Length: | 317 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017208421.2 |
Gene: | gcnt4b.1 / 798652 |
ZFINID: | ZDB-GENE-091118-69 |
Length: | 442 |
Species: | Danio rerio |
Alignment Length: | 40 |
Identity: | 11/40 - (27%) |
Similarity: | 19/40 - (47%) |
Gaps: | 2/40 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 FFGVSATIIIYIGGVLFLSMNNIPGSHPKRPRIERFAEFP 47
|.|.:..::||...:.||.:..:... .||.:.| .:|.|
Zfish 21 FVGFTLALLIYCFTISFLKVKGVQNG-GKRAKKE-ISEMP 58
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG9164 | NP_573021.1 |
Sulfotransfer_1 |
107..>271 |
CDD:304426 |
|
gcnt4b.1 | XP_017208421.2 |
Branch |
129..396 |
CDD:332239 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170592260 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.