DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9164 and gcnt4b.1

DIOPT Version :9

Sequence 1:NP_573021.1 Gene:CG9164 / 32467 FlyBaseID:FBgn0030634 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_017208421.2 Gene:gcnt4b.1 / 798652 ZFINID:ZDB-GENE-091118-69 Length:442 Species:Danio rerio


Alignment Length:40 Identity:11/40 - (27%)
Similarity:19/40 - (47%) Gaps:2/40 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FFGVSATIIIYIGGVLFLSMNNIPGSHPKRPRIERFAEFP 47
            |.|.:..::||...:.||.:..:... .||.:.| .:|.|
Zfish    21 FVGFTLALLIYCFTISFLKVKGVQNG-GKRAKKE-ISEMP 58

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9164NP_573021.1 Sulfotransfer_1 107..>271 CDD:304426
gcnt4b.1XP_017208421.2 Branch 129..396 CDD:332239
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592260
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.