DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9164 and KREMEN2

DIOPT Version :10

Sequence 1:NP_573021.1 Gene:CG9164 / 32467 FlyBaseID:FBgn0030634 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_757384.1 Gene:KREMEN2 / 79412 HGNCID:18797 Length:462 Species:Homo sapiens


Alignment Length:46 Identity:12/46 - (26%)
Similarity:18/46 - (39%) Gaps:20/46 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RFAEFPSFHSPRF---------------PM-PSRKMTI----RWCR 67
            |:.:.||.|.|.:               |. .|.|:|:    |:||
Human   112 RYCDIPSCHMPGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCR 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9164NP_573021.1 Sulfotransfer_3 <174..261 CDD:480665
KREMEN2NP_757384.1 KR 35..119 CDD:238056 2/6 (33%)
WSC 124..205 CDD:460348 7/34 (21%)
CUB 219..324 CDD:238001
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..352
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.