DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9164 and Kremen2

DIOPT Version :9

Sequence 1:NP_573021.1 Gene:CG9164 / 32467 FlyBaseID:FBgn0030634 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_006525046.3 Gene:Kremen2 / 73016 MGIID:1920266 Length:530 Species:Mus musculus


Alignment Length:75 Identity:15/75 - (20%)
Similarity:26/75 - (34%) Gaps:24/75 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RFAEFPSFHSPRF---------------PM-PSRKMTI----RWCR----DLKYINRDLPIYADY 82
            |:.:.|:.|.|.:               |. .|.|:|:    |:||    .|..:......:...
Mouse   180 RYCDIPTCHMPGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGS 244

  Fly    83 KSDFYTALPS 92
            :||.....|:
Mouse   245 ESDLARGRPA 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9164NP_573021.1 Sulfotransfer_1 107..>271 CDD:304426
Kremen2XP_006525046.3 KR 102..187 CDD:214527 2/6 (33%)
WSC 192..273 CDD:366825 11/63 (17%)
CUB 287..392 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.