DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9164 and Gcnt3

DIOPT Version :9

Sequence 1:NP_573021.1 Gene:CG9164 / 32467 FlyBaseID:FBgn0030634 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_082363.2 Gene:Gcnt3 / 72077 MGIID:1919327 Length:437 Species:Mus musculus


Alignment Length:212 Identity:42/212 - (19%)
Similarity:80/212 - (37%) Gaps:71/212 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 LLKTGFPAE---NVCNSSVLLVKTHEWGSKAWAPFSKAILLVRDPEKAIIAEFNRQSGGHIGFAS 200
            ||::..|.:   |.|.:. ..:||:       |...||:.|::. :.::.:|.            
Mouse   213 LLQSPVPWKYLLNTCGTD-FPIKTN-------AEMVKALKLLKG-QNSMESEV------------ 256

  Fly   201 PDRYKRTKGKYWQQ-----FVSNKLKGWEMMNLSWARNFTGSIKVVFYDDLVHH--TERELRSIL 258
            |..:|:::.||..:     .:::|.|.....||:.   |||:..:|...|.:.|  :..:.|.::
Mouse   257 PPPHKKSRWKYHYEVTDTLHMTSKRKTPPPNNLTM---FTGNAYMVASRDFIEHVFSNSKARQLI 318

  Fly   259 DFLQ--FPINEQ----LMRCAIMRKEGIFRRKKRLLSFD------------------------PY 293
            ::::  :..:|.    |.|.:.|.......||     ||                        ||
Mouse   319 EWVKDTYSPDEHLWATLQRASWMPGSDPLHRK-----FDLSDMRAIARLTKWYDHEGDIENGAPY 378

  Fly   294 TESMRAEVQNRRRIVYG 310
            |..  :.:..|...|||
Mouse   379 TSC--SGIHQRAVCVYG 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9164NP_573021.1 Sulfotransfer_1 107..>271 CDD:304426 29/147 (20%)
Gcnt3NP_082363.2 Branch 133..400 CDD:367100 42/212 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847054
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.