Sequence 1: | NP_573021.1 | Gene: | CG9164 / 32467 | FlyBaseID: | FBgn0030634 | Length: | 317 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001034649.1 | Gene: | Gcnt7 / 654821 | MGIID: | 3606143 | Length: | 433 | Species: | Mus musculus |
Alignment Length: | 222 | Identity: | 45/222 - (20%) |
---|---|---|---|
Similarity: | 77/222 - (34%) | Gaps: | 66/222 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 21 GVLFLSMNNIPGSHPKRPRIERFAEFPSF----HSPRFPMPSRKMTIRWCRDLKYINRDLPIYAD 81
Fly 82 YKSDFYTALPSDVSAALQS---LPALTALA-SFPGSGNTWLRYLLQQATGILTGSIYKDYGLLKT 142
Fly 143 GFPAENVCNSSVLLVKTHEWGSKAWAPFSKAI-LLVRDPEKAIIAEFNRQSGGHIGFASPDRYKR 206
Fly 207 TKGKYWQQFVSNKLK---------GWE 224 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9164 | NP_573021.1 | Sulfotransfer_1 | 107..>271 | CDD:304426 | 26/129 (20%) |
Gcnt7 | NP_001034649.1 | Branch | 115..374 | CDD:391737 | 45/222 (20%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 233..275 | 9/48 (19%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 413..433 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167847049 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |