DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9164 and Gcnt7

DIOPT Version :9

Sequence 1:NP_573021.1 Gene:CG9164 / 32467 FlyBaseID:FBgn0030634 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001034649.1 Gene:Gcnt7 / 654821 MGIID:3606143 Length:433 Species:Mus musculus


Alignment Length:222 Identity:45/222 - (20%)
Similarity:77/222 - (34%) Gaps:66/222 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GVLFLSMNNIPGSHPKRPRIERFAEFPSF----HSPRFPMPSRKMTIRWCRDLKYINRDLPIYAD 81
            |.:|||......:|....|::  ||....    |||          .:|...:....::.||..:
Mouse   166 GNIFLSSKTQKVAHDNLRRLQ--AEIDCMRDLVHSP----------FQWHYVMNLCGQEFPIKTN 218

  Fly    82 YKSDFYTALPSDVSAALQS---LPALTALA-SFPGSGNTWLRYLLQQATGILTGSIYKDYGLLKT 142
             |...|     |:....:.   .|.:|..| |.|.:|....:....:.:.....:|:|.      
Mouse   219 -KEIIY-----DIRTRWKGKNITPGVTPPANSKPKTGQGPPKPSPDENSYTAPNTIFKQ------ 271

  Fly   143 GFPAENVCNSSVLLVKTHEWGSKAWAPFSKAI-LLVRDPEKAIIAEFNRQSGGHIGFASPDRYKR 206
             .|..|:..||         ||..:|...|.: .::.||....:.::::.      ..||:::  
Mouse   272 -SPPHNLTISS---------GSAHYALTRKFVEFVLTDPRAKDMLQWSKD------IQSPEKH-- 318

  Fly   207 TKGKYWQQFVSNKLK---------GWE 224
                ||  ...|:||         |||
Mouse   319 ----YW--VTLNRLKDAPGATPDAGWE 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9164NP_573021.1 Sulfotransfer_1 107..>271 CDD:304426 26/129 (20%)
Gcnt7NP_001034649.1 Branch 115..374 CDD:391737 45/222 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 233..275 9/48 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 413..433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847049
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.