DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG9164 and XYLT2

DIOPT Version :9

Sequence 1:	NP_573021.1	Gene:	CG9164 / 32467	FlyBaseID:	FBgn0030634	Length:	317	Species:	Drosophila melanogaster
Sequence 2:	NP_071450.2	Gene:	XYLT2 / 64132	HGNCID:	15517	Length:	865	Species:	Homo sapiens

Alignment Length:	130	Identity:	28/130 - (21%)
Similarity:	51/130 - (39%)	Gaps:	33/130 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly     1 MALQGW-RFFGVSATII----IYIGGVLF---------LSMNNIPGSHPKRP-----RIERFAEF 46
            :|:|.| |...::||::    .|:....:         ::....|.|.|.||     |:.:|.|
Human   673 VAVQRWARGPNLTATVVWIDPTYVVATSYDITVDTETEVTQYKPPLSRPLRPGPWTVRLLQFWE- 736

  Fly    47 PSFHSPRFPMPSRKMTIRWCRDLKYINRDLPIYADYKSDFYTALPSDVSAALQSLPALTALASFP 111
                    |:...:..:   ..|.: ||.||:..|..|..:...|.: ....||...|:::.:.|
Human   737 --------PLGETRFLV---LPLTF-NRKLPLRKDDASWLHAGPPHN-EYMEQSFQGLSSILNLP 788

Fly 112 111
Human 789 788

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG9164	NP_573021.1	Sulfotransfer_1	107..>271	CDD:304426	1/5 (20%)
XYLT2	NP_071450.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	41..157
		Branch	234..486	CDD:280621
		UDP-xylose binding. /evidence=ECO:0000250\|UniProtKB:Q86Y38	296..298
		UDP-xylose binding. /evidence=ECO:0000250\|UniProtKB:Q86Y38	400..401
		UDP-xylose binding. /evidence=ECO:0000250\|UniProtKB:Q86Y38	504..505
		Xylo_C	519..699	CDD:289306	7/25 (28%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	846..865
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165156642
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.930