DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9164 and XYLT1

DIOPT Version :9

Sequence 1:NP_573021.1 Gene:CG9164 / 32467 FlyBaseID:FBgn0030634 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_071449.1 Gene:XYLT1 / 64131 HGNCID:15516 Length:959 Species:Homo sapiens


Alignment Length:194 Identity:40/194 - (20%)
Similarity:58/194 - (29%) Gaps:68/194 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 IERFAEFPSFHSPRFPMPSR------KMTIRW---------CRDLKYINRDLPIYADYKSDFYTA 89
            ||..||| :.:.|...:|.|      |:...|         ...|.:.||. ||..:.....:..
Human   799 IESTAEF-THYKPPLNLPLRPGVWTVKILHHWVPVAETKFLVAPLTFSNRQ-PIKPEEALKLHNG 861

  Fly    90 LPSDVSAALQSLPALTALASFP-------------GSGNTWLRYLLQQATGILTGSIYKDYGLLK 141
             |...:...||..:|..:.|.|             .|..|.|...|..    |.|.::....:..
Human   862 -PLRNAYMEQSFQSLNPVLSLPINPAQVEQARRNAASTGTALEGWLDS----LVGGMWTAMDICA 921

  Fly   142 TG---FPAENVCNSSVLLVKTHEWGSKAWAPFSKAILLVRDPEKAIIAEFNRQSGGHIGFASPD 202
            ||   .|....|:.:            ||:.||.      ||:            ..:|...||
Human   922 TGPTACPVMQTCSQT------------AWSSFSP------DPK------------SELGAVKPD 955

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9164NP_573021.1 Sulfotransfer_1 107..>271 CDD:304426 21/112 (19%)
XYLT1NP_071449.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..259
Branch 328..580 CDD:280621
UDP-xylose binding. /evidence=ECO:0000269|PubMed:29681470, ECO:0007744|PDB:6EJ7 390..392
UDP-xylose binding. /evidence=ECO:0000269|PubMed:29681470, ECO:0007744|PDB:6EJ7 494..495
UDP-xylose binding. /evidence=ECO:0000269|PubMed:29681470, ECO:0007744|PDB:6EJ7 598..599
Xylo_C 613..793 CDD:289306
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 940..959 7/34 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156643
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.