DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9164 and wscd1b

DIOPT Version :9

Sequence 1:NP_573021.1 Gene:CG9164 / 32467 FlyBaseID:FBgn0030634 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_005169248.1 Gene:wscd1b / 565449 ZFINID:ZDB-GENE-091118-93 Length:568 Species:Danio rerio


Alignment Length:243 Identity:86/243 - (35%)
Similarity:130/243 - (53%) Gaps:11/243 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 CRDLKYINR----DLPIYADYKSDFYTALPSDVSAALQSLPALTALASFPGSGNTWLRYLLQQAT 126
            |:.....|:    ||..|..|.:....|...:.|...|...:|.||:||||:||||||:|::..|
Zfish   304 CKKANQTNQTSLHDLDFYWVYSTPVLDATCKERSFLAQKSSSLVALSSFPGAGNTWLRHLIELVT 368

  Fly   127 GILTGSIYKDYGLLKTGFPAENVC--NSSVLLVKTHEWGSKAWAPFSKAILLVRDPEKAIIAEFN 189
            |..|||.|.|..|...||..|...  :..|:.|||||.|.:....|..||||:|:|.::::||||
Zfish   369 GFYTGSYYFDGSLYNKGFKGEKDYWQSGRVVCVKTHESGQREIQMFDSAILLMRNPYRSLMAEFN 433

  Fly   190 RQSGGHIGFASPDRYKRTKGKYWQQFVSNKLKGWEMMNLSWARNFTGSIKVVFYDDLVHHTEREL 254
            |:..||:|:||   :...:.|.|.:||.:....|....|:|.| |...:.||.::||......::
Zfish   434 RKCAGHLGYAS---HAHWRSKEWSEFVDSYSSWWVSHALAWLR-FAHRLLVVHFEDLQKDVVPQI 494

  Fly   255 RSILDFLQFPINEQLMRCAIMRKEGIFRRK-KRLLSFDPYTESMRAEV 301
            :::..||...|.|:.:.|....::|.|:|. ...|:|||::..|||.:
Zfish   495 KTVTAFLNISIPEERLLCIESDRDGHFKRSGSHNLNFDPFSPEMRARI 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9164NP_573021.1 Sulfotransfer_1 107..>271 CDD:304426 64/165 (39%)
wscd1bXP_005169248.1 WSC 134..213 CDD:307780
WSC 237..>286 CDD:321995
Sulfotransfer_3 349..547 CDD:328790 75/198 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I9574
eggNOG 1 0.900 - - E1_KOG4157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 146 1.000 Inparanoid score I4390
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D479708at33208
OrthoFinder 1 1.000 - - FOG0002523
OrthoInspector 1 1.000 - - otm25298
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45964
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2335
SonicParanoid 1 1.000 - - X1657
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.960

Return to query results.
Submit another query.