DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9164 and wscd2

DIOPT Version :9

Sequence 1:NP_573021.1 Gene:CG9164 / 32467 FlyBaseID:FBgn0030634 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_005165215.1 Gene:wscd2 / 561091 ZFINID:ZDB-GENE-060526-124 Length:580 Species:Danio rerio


Alignment Length:267 Identity:95/267 - (35%)
Similarity:139/267 - (52%) Gaps:40/267 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 DYKS----DFYTALPSDVS----AALQSLPA----LTALASFPGSGNTWLRYLLQQATGILTGSI 133
            |::|    ||:....:.|.    ...:.||.    |.|||||||:||||.|:|::.|||..|||.
Zfish   323 DFESCGNRDFFVVYQTQVQDNRCMDRRFLPTRSKHLMALASFPGAGNTWARHLIELATGYYTGSY 387

  Fly   134 YKDYGLLKTGFPAE--------NVCNSSVLLVKTHEWGSKAWAPFSKAILLVRDPEKAIIAEFNR 190
            |.|..|...||..|        .:|      :||||.|.|....|..:||::|:|.||::|||||
Zfish   388 YFDGSLYNKGFKGERDHWRSGRTIC------IKTHESGKKEIETFDASILMIRNPYKALMAEFNR 446

  Fly   191 QSGGHIGFASPDRYKRTKGKYWQQFVSNKLKGWEMMNLSWARNFTGSIKVVFYDDLVHHTERELR 255
            :.||||||||...:   :||.|.:||.|....|....|.|.: :...::||.::||......:|:
Zfish   447 KYGGHIGFASQAHW---RGKEWPEFVKNYAPWWASHTLDWLK-YGKKVQVVHFEDLKRDLFSQLK 507

  Fly   256 SILDFLQFPINEQLMRCAIMRKEGIFRRK-KRLLSFDPYTESMRA---------EVQNRRRIVYG 310
            .::.||...::|..:.|...:|:|.|:|. .|.|.:||||..|||         :::.|:|.:.|
Zfish   508 GMVIFLGLEVSEDRLLCVEGQKDGNFKRSGLRKLEYDPYTVEMRATIDRLIKTVDMELRKRNLSG 572

  Fly   311 LLGRQEP 317
            :.....|
Zfish   573 VPDEYRP 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9164NP_573021.1 Sulfotransfer_1 107..>271 CDD:304426 68/171 (40%)
wscd2XP_005165215.1 WSC 142..234 CDD:214616
WSC 245..339 CDD:214616 4/15 (27%)
Sulfotransfer_1 <413..559 CDD:304426 57/149 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592256
Domainoid 1 1.000 69 1.000 Domainoid score I9574
eggNOG 1 0.900 - - E1_KOG4157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 146 1.000 Inparanoid score I4390
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D479708at33208
OrthoFinder 1 1.000 - - FOG0002523
OrthoInspector 1 1.000 - - otm25298
orthoMCL 1 0.900 - - OOG6_107265
Panther 1 1.100 - - O PTHR45964
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2335
SonicParanoid 1 1.000 - - X1657
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.