DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9164 and gcnt4a

DIOPT Version :9

Sequence 1:NP_573021.1 Gene:CG9164 / 32467 FlyBaseID:FBgn0030634 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_963877.1 Gene:gcnt4a / 324510 ZFINID:ZDB-GENE-030131-3231 Length:428 Species:Danio rerio


Alignment Length:260 Identity:45/260 - (17%)
Similarity:83/260 - (31%) Gaps:91/260 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 IRWCRDLKYINRDLPIYADYK-----------SDFYTALPS--------------DVSAALQSLP 102
            ::|...:....:|.|:.::|:           :...|:.||              |||...|.:|
Zfish   205 VKWKYVINLCGQDFPLKSNYELVTELRKLNGANMLETSRPSKVKKQRFQFRYQLKDVSYEYQKMP 269

  Fly   103 ALTALASFPGSGNTWL-----RYLLQQ--ATGILTGSIYKDY--GLLKTGFPAENVCNSSVLLVK 158
            ..|::|..|...|..:     .::|.:  .|.::...:.||:  ..:.|..|.|           
Zfish   270 VKTSIAKDPPPHNIEMFVGSAYFVLSRDFVTYVMNNQLAKDFLQWSVDTYSPDE----------- 323

  Fly   159 THEWGSKAWAPFSKAILLVRDPEKAIIAEFNRQSGGHIGFASPDRYKRTKGKYWQQFVSNKLKG- 222
             |.|.|.|..|.....|...:|:.:.:               ..|.:..|..|.::.:..|..| 
Zfish   324 -HFWASMARVPGVPGELARSEPDVSDL---------------KSRTRLVKWNYLEERLYPKCTGT 372

  Fly   223 --------------WEMMNLSW-ARNFTGSIKVVFYDDLVHHTERELRSILDFLQFPINEQLMRC 272
                          |.:.:..| |..|...:..|    ::...|.:|.          .:||.:|
Zfish   373 HRRSVCIYGAAELRWLLEDGHWFANKFDPKVDPV----IIKCLEEKLE----------EKQLQQC 423

  Fly   273  272
            Zfish   424  423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9164NP_573021.1 Sulfotransfer_1 107..>271 CDD:304426 31/188 (16%)
gcnt4aNP_963877.1 Branch 120..388 CDD:280621 35/209 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592259
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.