DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9164 and Wscd2

DIOPT Version :9

Sequence 1:NP_573021.1 Gene:CG9164 / 32467 FlyBaseID:FBgn0030634 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_796266.2 Gene:Wscd2 / 320916 MGIID:2445030 Length:571 Species:Mus musculus


Alignment Length:291 Identity:102/291 - (35%)
Similarity:144/291 - (49%) Gaps:40/291 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 EFP-----------SFHSPRFPMPSR---KMTIRWCRDLKYINRDLPIYADYKSDFYTALPSDVS 95
            |||           .|.:.|||:..|   ::..:.|...::.:...|   .|...:.|.:..:..
Mouse   275 EFPLAALAGTACHCGFPTTRFPLHDREDEQLCAQKCSAEEFESCGTP---SYFIVYQTQVQDNRC 336

  Fly    96 AALQSLPA----LTALASFPGSGNTWLRYLLQQATGILTGSIYKDYGLLKTGFPAE--------N 148
            ...:.|||    |.|||||||:||||.|:|::.|||..|||.|.|..|...||..|        .
Mouse   337 MDRRFLPAKSKKLIALASFPGAGNTWARHLIELATGFYTGSYYFDGSLYNKGFKGERDHWRSGRT 401

  Fly   149 VCNSSVLLVKTHEWGSKAWAPFSKAILLVRDPEKAIIAEFNRQSGGHIGFASPDRYKRTKGKYWQ 213
            :|      :||||.|.|....|..||||:|:|.||::|||||:.|||||||:   :...|||.|.
Mouse   402 IC------IKTHESGQKEIEAFDAAILLIRNPYKALMAEFNRKYGGHIGFAA---HAHWKGKEWP 457

  Fly   214 QFVSNKLKGWEMMNLSWARNFTGSIKVVFYDDLVHHTERELRSILDFLQFPINEQLMRCAIMRKE 278
            :||.|....|....|.|.: |..::.||.::||......:|..::..|...:.|..:.|...:|:
Mouse   458 EFVRNYAPWWATHTLDWLK-FGKTVLVVHFEDLKQDLFTQLGRMVSLLGVAVREDRLLCVESQKD 521

  Fly   279 GIFRRK-KRLLSFDPYTESMRAEVQNRRRIV 308
            |.|:|. .|.|.:||||..||..:....|:|
Mouse   522 GNFKRSGLRKLEYDPYTAEMRRTIAAYIRMV 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9164NP_573021.1 Sulfotransfer_1 107..>271 CDD:304426 70/171 (41%)
Wscd2NP_796266.2 WSC 134..225 CDD:214616
WSC 236..330 CDD:214616 11/57 (19%)
Sulfotransfer_3 <421..>513 CDD:389806 37/95 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847048
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002523
OrthoInspector 1 1.000 - - otm43076
orthoMCL 1 0.900 - - OOG6_107265
Panther 1 1.100 - - O PTHR45964
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2335
SonicParanoid 1 1.000 - - X1657
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.730

Return to query results.
Submit another query.