DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9164 and Wscd1

DIOPT Version :9

Sequence 1:NP_573021.1 Gene:CG9164 / 32467 FlyBaseID:FBgn0030634 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001019405.1 Gene:Wscd1 / 287466 RGDID:1308212 Length:572 Species:Rattus norvegicus


Alignment Length:243 Identity:86/243 - (35%)
Similarity:124/243 - (51%) Gaps:20/243 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LPIYAD-YKSDFYTALPSDVSAALQSLPALTALASFPGSGNTWLRYLLQQATGILTGSIYKDYGL 139
            ||.|.: |::.......:|............||:||||:||||.|:|::.|||..|||.|.|..|
  Rat   321 LPGYCEVYQTPVQDTRCTDRKFLPNKSKVFVALSSFPGAGNTWARHLIEHATGFYTGSYYFDGTL 385

  Fly   140 LKTGFPAE--------NVCNSSVLLVKTHEWGSKAWAPFSKAILLVRDPEKAIIAEFNRQSGGHI 196
            ...||..|        .:|      |||||.|.:....|..||||:|:|.::::|||||:..||:
  Rat   386 YNKGFKGEKDHWRSRRTIC------VKTHESGRREIEMFDSAILLIRNPYRSLVAEFNRKCAGHL 444

  Fly   197 GFASPDRYKRTKGKYWQQFVSNKLKGWEMMNLSWARNFTGSIKVVFYDDLVHHTERELRSILDFL 261
            |:| |||  ..|.|.|..||::....|....|.|.: :...:.||.|::|.|.....||.::.||
  Rat   445 GYA-PDR--NWKSKEWPDFVNSYASWWSSHVLDWLK-YGKRLLVVHYEELRHSLVPTLREMVAFL 505

  Fly   262 QFPINEQLMRCAIMRKEGIFRRKKR-LLSFDPYTESMRAEVQNRRRIV 308
            ...::|:.:.|....|||.|||:.| ....:|:|..|:..:....|.|
  Rat   506 NVSVSEERLLCVENNKEGSFRRRGRHPHDQEPFTPEMKDLINGYIRTV 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9164NP_573021.1 Sulfotransfer_1 107..>271 CDD:304426 67/171 (39%)
Wscd1NP_001019405.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..135
WSC 139..231 CDD:214616
WSC 242..337 CDD:214616 4/15 (27%)
Sulfotransfer_1 <422..551 CDD:304426 46/132 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I10037
eggNOG 1 0.900 - - E1_KOG4157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D479708at33208
OrthoFinder 1 1.000 - - FOG0002523
OrthoInspector 1 1.000 - - otm45142
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45964
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1657
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.880

Return to query results.
Submit another query.