DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG9164 and GCNT1

DIOPT Version :9

Sequence 1:	NP_573021.1	Gene:	CG9164 / 32467	FlyBaseID:	FBgn0030634	Length:	317	Species:	Drosophila melanogaster
Sequence 2:	NP_001091102.1	Gene:	GCNT1 / 2650	HGNCID:	4203	Length:	428	Species:	Homo sapiens

Alignment Length:	118	Identity:	22/118 - (18%)
Similarity:	37/118 - (31%)	Gaps:	50/118 - (42%)

- Green bases have known domain annotations that are detailed below.

  Fly    56 MPSRKMTIRWCRDLKYINRDLPIYADYKSDFYTALPSDVSAALQSLPALTALASFPGSGNTWLRY 120
            |||.|.. ||.:..:.:|..|                ..:..::.||.|
Human   247 MPSHKEE-RWKKRYEVVNGKL----------------TNTGTVKMLPPL---------------- 278

  Fly   121 LLQQATGILTGSIY----KDYGLLKTGFPAENVCNSSVLLVKTHEWGSKAWAP 169
                .|.:.:||.|    ::|    .|:..:|     ..:.|..||....::|
Human   279 ----ETPLFSGSAYFVVSREY----VGYVLQN-----EKIQKLMEWAQDTYSP 318

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG9164	NP_573021.1	Sulfotransfer_1	107..>271	CDD:304426	11/67 (16%)
GCNT1	NP_001091102.1	Mediates interaction with GOLPH3 and is necessary and sufficient for localization to the Golgi. /evidence=ECO:0000269\|PubMed:23027862	5..9
		Stem region. /evidence=ECO:0000250	33..121
		Catalytic. /evidence=ECO:0000250	122..428		22/118 (19%)
		Branch	123..391	CDD:308216	22/118 (19%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165156636
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.930