DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9164 and wsc1

DIOPT Version :9

Sequence 1:NP_573021.1 Gene:CG9164 / 32467 FlyBaseID:FBgn0030634 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_595526.2 Gene:wsc1 / 2540969 PomBaseID:SPBC30B4.01c Length:374 Species:Schizosaccharomyces pombe


Alignment Length:103 Identity:24/103 - (23%)
Similarity:39/103 - (37%) Gaps:35/103 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 TALPSDVSAALQSLPALTALASFPGSGNT-------WLRYLLQQATGILTGSIYKDYGLLKTGFP 145
            |...::||::|.:.|.       ||.|:.       |..|        |||:     |:|:|   
pombe    84 TLTATEVSSSLCTTPC-------PGYGSLMCGGDLYWSVY--------LTGN-----GVLQT--- 125

  Fly   146 AENVCNSSVLLVKTHEWGSKAWAPFSKAILLVRDPEKA 183
              .|.:|||....:   .|.:.:|.|.:......|..:
pombe   126 --TVSSSSVSSTTS---SSSSSSPSSSSTTTTTSPSSS 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9164NP_573021.1 Sulfotransfer_1 107..>271 CDD:304426 19/84 (23%)
wsc1NP_595526.2 WSC 31..119 CDD:295370 11/49 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.