DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9164 and Xylt1

DIOPT Version :9

Sequence 1:NP_573021.1 Gene:CG9164 / 32467 FlyBaseID:FBgn0030634 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_783576.2 Gene:Xylt1 / 233781 MGIID:2451073 Length:953 Species:Mus musculus


Alignment Length:196 Identity:39/196 - (19%)
Similarity:61/196 - (31%) Gaps:72/196 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 IERFAEFPSFHSPRFPMPSR------KMTIRW--CRDLKYINRDL------PIYADYKSDFYTAL 90
            ||..||| :.:.|...:|.|      |:...|  ..:.|::...|      ||..:.....:...
Mouse   793 IESTAEF-THYKPPLNLPLRPGVWTVKILHHWVPVAETKFLVAPLTFSNKQPIKPEEALKLHNGP 856

  Fly    91 PSD--VSAALQSLPALTAL-------------ASFPGSG-NTWLRYLLQQATGILTGSIYKDYGL 139
            |..  :..:.|||..:.:|             |:|.|:. ..||        ..|.|..:....:
Mouse   857 PRSAYMEQSFQSLNPVLSLHINPAQVEQARKNAAFTGTALEAWL--------DSLVGGTWTAMDI 913

  Fly   140 LKTG---FPAENVCNSSVLLVKTHEWGSKAWAPFSKAILLVRDPEKAIIAEFNRQSGGHIGFASP 201
            ..||   .|....|:.:            ||:.||.      ||:            ..:|...|
Mouse   914 CTTGPTACPVMQTCSQT------------AWSSFSP------DPK------------SELGAVKP 948

  Fly   202 D 202
            |
Mouse   949 D 949

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9164NP_573021.1 Sulfotransfer_1 107..>271 CDD:304426 21/113 (19%)
Xylt1NP_783576.2 Branch 322..574 CDD:280621
Xylo_C 607..787 CDD:289306
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847053
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.