Sequence 1: | NP_573021.1 | Gene: | CG9164 / 32467 | FlyBaseID: | FBgn0030634 | Length: | 317 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_783576.2 | Gene: | Xylt1 / 233781 | MGIID: | 2451073 | Length: | 953 | Species: | Mus musculus |
Alignment Length: | 196 | Identity: | 39/196 - (19%) |
---|---|---|---|
Similarity: | 61/196 - (31%) | Gaps: | 72/196 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 40 IERFAEFPSFHSPRFPMPSR------KMTIRW--CRDLKYINRDL------PIYADYKSDFYTAL 90
Fly 91 PSD--VSAALQSLPALTAL-------------ASFPGSG-NTWLRYLLQQATGILTGSIYKDYGL 139
Fly 140 LKTG---FPAENVCNSSVLLVKTHEWGSKAWAPFSKAILLVRDPEKAIIAEFNRQSGGHIGFASP 201
Fly 202 D 202 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9164 | NP_573021.1 | Sulfotransfer_1 | 107..>271 | CDD:304426 | 21/113 (19%) |
Xylt1 | NP_783576.2 | Branch | 322..574 | CDD:280621 | |
Xylo_C | 607..787 | CDD:289306 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167847053 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |