DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9164 and WSCD1

DIOPT Version :9

Sequence 1:NP_573021.1 Gene:CG9164 / 32467 FlyBaseID:FBgn0030634 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001375334.1 Gene:WSCD1 / 23302 HGNCID:29060 Length:575 Species:Homo sapiens


Alignment Length:344 Identity:104/344 - (30%)
Similarity:153/344 - (44%) Gaps:65/344 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GGVLFLSMNNI----PGSHPKRPRIERFA---------EFPS--------------FHSPR-FPM 56
            |.|..||:..:    |||..:|....|..         .|||              |.|.: ||:
Human   223 GAVDRLSVYRVDELQPGSRKRRTATYRGCFRLPENITHAFPSSLIQANVTVGTCSGFCSQKEFPL 287

  Fly    57 ------------PSRKMTIRWCRDLKYINRD--LPIYADYKSDFYTALPSDVSAALQSLP----A 103
                        |:.:..:|...|.....:|  ....|:|...:.|.:........:.||    .
Human   288 AILRGWECYCAYPTPRFNLRDAMDSSVCGQDPEAQRLAEYCEVYQTPVQDTRCTDRRFLPNKSKV 352

  Fly   104 LTALASFPGSGNTWLRYLLQQATGILTGSIYKDYGLLKTGFPAE--------NVCNSSVLLVKTH 160
            ..||:||||:||||.|:|::.|||..|||.|.|..|...||..|        .:|      ||||
Human   353 FVALSSFPGAGNTWARHLIEHATGFYTGSYYFDGTLYNKGFKGEKDHWRSRRTIC------VKTH 411

  Fly   161 EWGSKAWAPFSKAILLVRDPEKAIIAEFNRQSGGHIGFASPDRYKRTKGKYWQQFVSNKLKGWEM 225
            |.|.:....|..||||:|:|.::::|||||:..||:|:|: ||  ..|.|.|..||::....|..
Human   412 ESGRREIEMFDSAILLIRNPYRSLVAEFNRKCAGHLGYAA-DR--NWKSKEWPDFVNSYASWWSS 473

  Fly   226 MNLSWARNFTGSIKVVFYDDLVHHTERELRSILDFLQFPINEQLMRCAIMRKEGIFRRK-KRLLS 289
            ..|.|.: :...:.||.|::|.......||.::.||...::|:.:.|....|||.|||: :|...
Human   474 HVLDWLK-YGKRLLVVHYEELRRSLVPTLREMVAFLNVSVSEERLLCVENNKEGSFRRRGRRSHD 537

  Fly   290 FDPYTESMRAEVQNRRRIV 308
            .:|:|..|:..:....|.|
Human   538 PEPFTPEMKDLINGYIRTV 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9164NP_573021.1 Sulfotransfer_1 107..>271 CDD:304426 65/171 (38%)
WSCD1NP_001375334.1 WSC 142..234 CDD:214616 4/10 (40%)
WSC 245..340 CDD:214616 15/94 (16%)
Sulfotransfer_3 <425..>517 CDD:419727 33/95 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10824
eggNOG 1 0.900 - - E1_KOG4157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4723
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D479708at33208
OrthoFinder 1 1.000 - - FOG0002523
OrthoInspector 1 1.000 - - otm41005
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45964
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1657
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.830

Return to query results.
Submit another query.