DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9164 and Wscd1

DIOPT Version :9

Sequence 1:NP_573021.1 Gene:CG9164 / 32467 FlyBaseID:FBgn0030634 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001344889.1 Gene:Wscd1 / 216881 MGIID:2448493 Length:572 Species:Mus musculus


Alignment Length:354 Identity:107/354 - (30%)
Similarity:153/354 - (43%) Gaps:85/354 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GGVLFLSMNNI----PGSHPKRPRIERFAEFPSFHSPRFPMPSR------------KMTIRWCRD 68
            |.|..||:.::    |||..:|....|..         ||:|..            .||:..|..
Mouse   220 GAVRRLSVYSVGLQQPGSKKRRTATYRGC---------FPLPENVTHTFSSSMTQANMTVETCSG 275

  Fly    69 LKYINRDLPIYADYKSDFYTALPSD-------VSAAL-------QSLP----------------- 102
            . ...::.|:......|.|.|.|:.       |..||       |.||                 
Mouse   276 F-CSQKEFPLAILRGWDCYCAYPTPQFSLRDAVDGALCSQAPETQGLPGYCEVYQTPVQDTRCTD 339

  Fly   103 ---------ALTALASFPGSGNTWLRYLLQQATGILTGSIYKDYGLLKTGFPAE--------NVC 150
                     ...||:||||:||||.|:|::.|||..|||.|.|..|...||..|        .:|
Mouse   340 RKFLPDKSKVFVALSSFPGAGNTWARHLIEHATGFYTGSYYFDGTLYNKGFKGEKDHWRSRRTIC 404

  Fly   151 NSSVLLVKTHEWGSKAWAPFSKAILLVRDPEKAIIAEFNRQSGGHIGFASPDRYKRTKGKYWQQF 215
                  |||||.|.:....|..||||:|:|.::::|||||:..||:|:| |||  ..|.|.|.:|
Mouse   405 ------VKTHESGRREIEMFDSAILLIRNPYRSLVAEFNRKCAGHLGYA-PDR--NWKSKEWPEF 460

  Fly   216 VSNKLKGWEMMNLSWARNFTGSIKVVFYDDLVHHTERELRSILDFLQFPINEQLMRCAIMRKEGI 280
            |::....|....|.|.: :...:.||.|::|.|.....||.::.||...::|:.:.|....|||.
Mouse   461 VNSYASWWSSHVLDWLK-YGKRLLVVHYEELRHSLVPTLREMVAFLNVSVSEERLLCVENNKEGS 524

  Fly   281 FRRK-KRLLSFDPYTESMRAEVQNRRRIV 308
            |||: :|....:|:|..|:..:....|.|
Mouse   525 FRRRGRRPHDQEPFTPEMKDLINGYIRTV 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9164NP_573021.1 Sulfotransfer_1 107..>271 CDD:304426 67/171 (39%)
Wscd1NP_001344889.1 WSC 139..231 CDD:214616 4/10 (40%)
WSC 242..337 CDD:214616 18/104 (17%)
Sulfotransfer_3 <422..551 CDD:419727 46/132 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I10170
eggNOG 1 0.900 - - E1_KOG4157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4723
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D479708at33208
OrthoFinder 1 1.000 - - FOG0002523
OrthoInspector 1 1.000 - - otm43076
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45964
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2335
SonicParanoid 1 1.000 - - X1657
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.860

Return to query results.
Submit another query.