DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9164 and sqv-6

DIOPT Version :9

Sequence 1:NP_573021.1 Gene:CG9164 / 32467 FlyBaseID:FBgn0030634 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_503359.2 Gene:sqv-6 / 190099 WormBaseID:WBGene00005024 Length:806 Species:Caenorhabditis elegans


Alignment Length:180 Identity:37/180 - (20%)
Similarity:63/180 - (35%) Gaps:57/180 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 LTALASFPGSGNTWLRYLLQQATGILTGSIYKDYGLLKTGF---PAENVCNSSVLLVKTHEWGSK 165
            |....|| |:...|...|.::..|.:|     |...|.|..   |.|:|          .:.|.|
 Worm   628 LLRAVSF-GTKFEWKEELCREYMGFVT-----DNDTLHTRLQWHPTEHV----------KKVGDK 676

  Fly   166 AWAP-----FSKAILLVRDPEKAIIAEFNRQSGGHIGFASPDRYKRTKGKYWQQFVSNKLKGWEM 225
            . :|     :.|...|:   |:.::..::...||                   ||.|..: |.::
 Worm   677 T-SPEMIFKYRKGDELI---EQTVVKPYDSVFGG-------------------QFDSWNV-GKKL 717

  Fly   226 MNLSWARNFTGSIKVVFYDDLVHHTERELRSILDFLQFPI-NEQLMRCAI 274
            .||:...|        |:.|::..:..:....|..|.||: .:|...|.:
 Worm   718 SNLTTCSN--------FFVDIISPSSPDDAPPLATLHFPVYTDQNAHCHV 759

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9164NP_573021.1 Sulfotransfer_1 107..>271 CDD:304426 35/172 (20%)
sqv-6NP_503359.2 WSC 113..195 CDD:280068
Branch 246..485 CDD:280621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4723
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.