powered by:
Protein Alignment CG9164 and T28F3.9
DIOPT Version :9
Sequence 1: | NP_573021.1 |
Gene: | CG9164 / 32467 |
FlyBaseID: | FBgn0030634 |
Length: | 317 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_503076.1 |
Gene: | T28F3.9 / 189057 |
WormBaseID: | WBGene00012135 |
Length: | 513 |
Species: | Caenorhabditis elegans |
Alignment Length: | 54 |
Identity: | 12/54 - (22%) |
Similarity: | 21/54 - (38%) |
Gaps: | 17/54 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 99 QSLPALTALASFPGSGN-----------------TWLRYLLQQATGILTGSIYK 135
:::..|.|..||..||: .|...||.|...:::.|:|:
Worm 221 ENIIVLPAEHSFDSSGHNQNLGHTECMQSLLQFENWTYLLLLQNHDVISKSVYE 274
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160164649 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.