DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9164 and T27F6.1

DIOPT Version :9

Sequence 1:NP_573021.1 Gene:CG9164 / 32467 FlyBaseID:FBgn0030634 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_493165.3 Gene:T27F6.1 / 189003 WormBaseID:WBGene00012102 Length:461 Species:Caenorhabditis elegans


Alignment Length:192 Identity:39/192 - (20%)
Similarity:57/192 - (29%) Gaps:79/192 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 LPSDVS-------AALQSLPALTALASFPGSGNTWLRYLLQQATGILTGSIYKDYGLLKTGFPAE 147
            ||.|:|       ..|.....|.||.:.||    |...:|.|...::|.|:|:            
 Worm   181 LPDDLSVDSHGHNTNLAHYNCLRALINKPG----WNYAILLQNHDLITKSVYE------------ 229

  Fly   148 NVCNSSVLLVKTHEWGSKAWAPFSKAILLVRDPEKAIIAEFNRQSGGHIGFASPDRYKRTKGKYW 212
                    |.|...|...|             .:.||..|..|....|        :|       
 Worm   230 --------LEKIFNWLGGA-------------NDVAIRPELGRLDKKH--------FK------- 258

  Fly   213 QQFVSNKLKGWEMMNLSWARNFTGSIKVVFYDDLVHHTERELRSILDFLQFPINEQLMRCAI 274
                      |:.|:|...||.:.|    ..|.::      |.:.|.|.:..:...|.|.|:
 Worm   259 ----------WDPMSLKLFRNVSES----EIDPVI------LNTTLKFAKGAVQSSLSRAAV 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9164NP_573021.1 Sulfotransfer_1 107..>271 CDD:304426 30/163 (18%)
T27F6.1NP_493165.3 Branch 125..392 CDD:280621 39/192 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164647
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.