DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9164 and T09E11.9

DIOPT Version :9

Sequence 1:NP_573021.1 Gene:CG9164 / 32467 FlyBaseID:FBgn0030634 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_493125.2 Gene:T09E11.9 / 188337 WormBaseID:WBGene00011658 Length:490 Species:Caenorhabditis elegans


Alignment Length:199 Identity:41/199 - (20%)
Similarity:66/199 - (33%) Gaps:74/199 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 LQSLPALTALASFPGSGNTWLRYLLQQATGILTGSIYKDYGLLKTGFPAENVCNSSVLLVKTHEW 162
            |..|..|.||.:.||    |...:|.|...:||.|:|:                    |.:.:||
 Worm   217 LAHLNCLRALINKPG----WNYAMLLQNHDLLTKSVYE--------------------LEQVYEW 257

  Fly   163 GSKA------------------WAPFSKAILLVRDPEKAIIAEFNRQSGGHIGFASPDRYKRTKG 209
            ...|                  |.|  :::.:..|..|......|            ::.|.:||
 Worm   258 LGGANDVELLPEAQRLDEENFKWDP--RSLKMFPDESKVDETILN------------EKIKFSKG 308

  Fly   210 KYWQQFVSNKLKGW--EMMNLS-----WARNFTG-------SIKV-VFYDDLVHHTERELR--SI 257
            .. |..:|.....|  ..:|||     |.:...|       |::: .|.....|.|::.|:  .:
 Worm   309 GV-QGSMSRAAVDWMTRKVNLSTYIDQWNQGRWGVDEMLISSLQISAFLGMPGHFTDQCLKEGKV 372

  Fly   258 LDFL 261
            .||:
 Worm   373 TDFI 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9164NP_573021.1 Sulfotransfer_1 107..>271 CDD:304426 37/190 (19%)
T09E11.9NP_493125.2 Branch 146..411 CDD:280621 41/199 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164653
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.