DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9164 and F30A10.4

DIOPT Version :9

Sequence 1:NP_573021.1 Gene:CG9164 / 32467 FlyBaseID:FBgn0030634 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001361850.1 Gene:F30A10.4 / 185124 WormBaseID:WBGene00009263 Length:476 Species:Caenorhabditis elegans


Alignment Length:281 Identity:45/281 - (16%)
Similarity:102/281 - (36%) Gaps:79/281 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LKYINRDLPIYADYKSDFYTALPSDVSAALQSLPA-LTALASFPGSGNTWL----RYLLQQATGI 128
            ||:|.|.:..:|||   ::|...|......:.:.. :.::.::..:|...|    .:.|......
 Worm    66 LKHITRSITKFADY---YFTESESRYLNCARLIDGDVESIDTYVNNGRMKLDEEKLFQLSMDCDS 127

  Fly   129 LTGSIYKD-----------------YGL-------LKTGFPAEN-VCNSSVLLVKTHEWGSKAWA 168
            :...|::|                 ||:       |...:..:| .|         :...||:..
 Worm   128 IQNRIFRDMPPFEKLKRPIAFVRNIYGIYELQEVFLSISYHPDNYFC---------YAMDSKSSE 183

  Fly   169 PFSKAILLVRDPEKAIIA---EFNRQSGGHIGFASP-DRYKRTKGKYWQQFVSNKLKGWEMMNLS 229
            ...|::.::.|..:.:|.   |::....||...|:. |..|:...::|...::            
 Worm   184 KLKKSMRIMADCFENVIVLDKEYDMDRAGHKQDAAHFDCLKQILDEHWSHAIT------------ 236

  Fly   230 WARNFTGSIKVVFYDDLVHHTERELRSILDFLQFPINEQLMRCAIMRKEGIFRRKKRLLSFDPYT 294
             .:||          ||:..:.::|..:.:.|.:        .:||..:..|..:.|  :|:.:|
 Worm   237 -LQNF----------DLIIKSPKQLSDLSEILNY--------TSIMGFDYGFTSRYR--TFEDWT 280

  Fly   295 ESMRAEVQNRRRIVYGLLGRQ 315
            .:.....:|.:.:...:|.::
 Worm   281 PAGMKLFKNEQSVPLEILHKK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9164NP_573021.1 Sulfotransfer_1 107..>271 CDD:304426 28/196 (14%)
F30A10.4NP_001361850.1 Branch 146..411 CDD:391737 31/198 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164646
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.