DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9164 and F26D2.3

DIOPT Version :9

Sequence 1:NP_573021.1 Gene:CG9164 / 32467 FlyBaseID:FBgn0030634 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001023854.1 Gene:F26D2.3 / 180103 WormBaseID:WBGene00009148 Length:476 Species:Caenorhabditis elegans


Alignment Length:142 Identity:26/142 - (18%)
Similarity:43/142 - (30%) Gaps:61/142 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 RFPMPSRKMTIRWCRDLKYINRDLP------------------IYADY-------------KSDF 86
            |.|:.........|..:|  ||.:|                  ::|||             ::.|
 Worm   101 RIPLIENPFLNLTCSAIK--NRIIPKSSQFKLLMLNGTAFARIVFADYEFIEKQVQASYHPQNFF 163

  Fly    87 YTALPSDVSAALQS--------LP---ALTALASFPGSGNT-----------------WLRYLLQ 123
            ..|:.::.||..|.        ||   .|....|:...|:.                 |...:|.
 Worm   164 CFAVDANSSAEFQKRMKALERCLPNVFVLPVTESYDSKGHNINLAHYNCMKRLEASRGWGYLMLL 228

  Fly   124 QATGILTGSIYK 135
            |...::|.|:|:
 Worm   229 QNHDVITKSVYE 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9164NP_573021.1 Sulfotransfer_1 107..>271 CDD:304426 8/46 (17%)
F26D2.3NP_001023854.1 Branch 137..394 CDD:280621 19/104 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164648
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.