DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9164 and gly-19

DIOPT Version :10

Sequence 1:NP_573021.1 Gene:CG9164 / 32467 FlyBaseID:FBgn0030634 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_492015.1 Gene:gly-19 / 172447 WormBaseID:WBGene00001644 Length:436 Species:Caenorhabditis elegans


Alignment Length:96 Identity:25/96 - (26%)
Similarity:36/96 - (37%) Gaps:36/96 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 SNKLKGWEMMNLSWARNFTGSIKVVFYDDLVHHTERELRSILDFLQFPINEQLMRCAIMRKEGIF 281
            ||.|||::.           :.|:    |::|         ||.    |.|||..|.     ...
 Worm    62 SNILKGYKT-----------NEKL----DIMH---------LDI----IEEQLFSCT-----NKC 93

  Fly   282 RRKKRLLSFDPYTESMRAEVQNRRRIVYGLL 312
            :..|.|..|:  |..|.|| :....:.||:|
 Worm    94 QTLKTLFRFN--TNPMSAE-EKHFPLSYGML 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9164NP_573021.1 Sulfotransfer_3 <174..261 CDD:480665 10/43 (23%)
gly-19NP_492015.1 Branch 116..307 CDD:452742 3/6 (50%)

Return to query results.
Submit another query.