DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9164 and gly-18

DIOPT Version :9

Sequence 1:NP_573021.1 Gene:CG9164 / 32467 FlyBaseID:FBgn0030634 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_492014.4 Gene:gly-18 / 172446 WormBaseID:WBGene00001643 Length:440 Species:Caenorhabditis elegans


Alignment Length:346 Identity:70/346 - (20%)
Similarity:109/346 - (31%) Gaps:126/346 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RFFGVSATIIIYIGGVLFLSMNNIPGSHPKRPRIERFAEFPSFHSPRFPMPSRKMT--------- 62
            |..|...:::.|...|:||.:..:      :|.:.|..|  |.:|.|.|..:..::         
 Worm     3 RLKGTIPSLVTYAALVIFLYLFIV------KPLVPRILE--SLNSSRNPQETSILSKIENDLLDD 59

  Fly    63 -----------IRWCRDLKYIN----RDLPIYADYKSDFYTALPSDVSAALQSL------PALTA 106
                       .:....|:.:|    .|..:|:           :|....|:||      |....
 Worm    60 LDINCLNIFNGSKNRNQLRIVNSRSIEDKLLYS-----------TDRCQTLKSLFRFNKVPLSPE 113

  Fly   107 LASFPGSGNTWLRYLLQQATGILTGSIY---KDY-------------GLLKTGFPAENVCNSSVL 155
            ..|||.|....:...|.|...:|: |||   .:|             .|||   ...| |.|::.
 Worm   114 EESFPLSYGLLVYKELSQVLFMLS-SIYHPQNEYCIAVGENSAPIFQNLLK---ELSN-CFSNIH 173

  Fly   156 LVKTH--EWGS------------------KAWAPFSKAILLVRDPEKA------IIAEFNRQSGG 194
            .:|..  :|||                  ..|..| :.:..|..|.|.      |:...|..:..
 Worm   174 FMKRPPIDWGSHEIINSAYDCLEFLSHLKSDWRYF-QYLSGVDIPLKTNLEMVQILKHLNGTANV 237

  Fly   195 HIGFASPDRYKRTKGKYWQQFVSNKLKGWEMMNLSWARNFTGSIKVVFYDDLVHHTERELRSILD 259
            .|   .|.:|:|.:||                      |.|.|...:|...|.....||..:.|.
 Worm   238 EI---KPYQYQRLRGK----------------------NETQSPLPLFKSSLSSLIPREAANHLS 277

  Fly   260 FLQFPINEQLMRCAIMRKEGI 280
            ....|  :||:.  .:|..||
 Worm   278 SSSIP--QQLLE--FLRNTGI 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9164NP_573021.1 Sulfotransfer_1 107..>271 CDD:304426 45/205 (22%)
gly-18NP_492014.4 Branch 136..373 CDD:280621 42/194 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164641
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.