DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9164 and gcnt3

DIOPT Version :10

Sequence 1:NP_573021.1 Gene:CG9164 / 32467 FlyBaseID:FBgn0030634 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_002666963.1 Gene:gcnt3 / 100332076 ZFINID:ZDB-GENE-110411-253 Length:432 Species:Danio rerio


Alignment Length:122 Identity:27/122 - (22%)
Similarity:44/122 - (36%) Gaps:38/122 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 MNNIPGSHPKRPRIE--------RFAEFPSFHS----------PRFPMPSRKMTIRWCRDLKYIN 73
            |.::|||:....:.|        |..:: |:|.          |...|..|.:.:....|||:|.
Zfish   323 MPSVPGSNSPNNKYEQSDMNAIARLVKW-SYHEGDLNSGAPYPPCTGMHRRSVCVYGAGDLKWIV 386

  Fly    74 RDLPIYADYKSDFYTALPSDVSAALQSLPALTALASFPGSGNTWLRYLLQQATGILT 130
            |...:.|: |.|     |.....|::.:.|             :|||.......:||
Zfish   387 RQHHLLAN-KFD-----PEVDDVAIKCMEA-------------FLRYKAVYGRSLLT 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9164NP_573021.1 Sulfotransfer_3 <174..261 CDD:480665
gcnt3XP_002666963.1 Branch 119..386 CDD:426795 14/63 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.