DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9164 and wscd2

DIOPT Version :10

Sequence 1:NP_573021.1 Gene:CG9164 / 32467 FlyBaseID:FBgn0030634 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001106553.1 Gene:wscd2 / 100127745 XenbaseID:XB-GENE-6039192 Length:230 Species:Xenopus tropicalis


Alignment Length:102 Identity:25/102 - (24%)
Similarity:33/102 - (32%) Gaps:41/102 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RFFGVSATIIIYI--GGVLFL-------------------SMNNIP-----GSHPKRPRIERFAE 45
            |||   ..||:|:  |.|:||                   ..:|.|     |..|.....:...|
 Frog    18 RFF---TFIILYLTAGSVVFLHASFEGEQIVSDNDKTSVDGTSNGPDVQELGIAPLSRVFKEVPE 79

  Fly    46 FPSFH---SPRFPMPSRKMTIR---------WCRDLK 70
            .||.|   .|....|.:::..|         |.|.||
 Frog    80 SPSTHRRYGPWLKTPGKELPERIKQGEFGGTWNRALK 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9164NP_573021.1 Sulfotransfer_3 <174..261 CDD:480665
wscd2NP_001106553.1 WSC 127..219 CDD:214616
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.