DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6227 and eIF4A

DIOPT Version :9

Sequence 1:NP_573020.2 Gene:CG6227 / 32464 FlyBaseID:FBgn0030631 Length:1224 Species:Drosophila melanogaster
Sequence 2:NP_001245907.1 Gene:eIF4A / 33835 FlyBaseID:FBgn0001942 Length:403 Species:Drosophila melanogaster


Alignment Length:395 Identity:127/395 - (32%)
Similarity:216/395 - (54%) Gaps:31/395 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   511 TWAQCGVSKKEM----EVLRRL---GFEKPTPIQCQAIPAIMSGRDLIGIAKTGSGKTLAFILPM 568
            ||.:...:..:|    |:||.:   |||||:.||.:||...:.|||:|..|::|:|||..|.:.:
  Fly    24 TWHEVYDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAI 88

  Fly   569 FRHILDQPSMEDGDGAI----AIIMAPTRELCMQIGKDIRKFSKSLGLRPVCVYGGTGISEQIAE 629
            .:.|         |.:|    |:|:||||||..||.:.:....:.:.:......|||.:.|....
  Fly    89 LQQI---------DTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVREDARI 144

  Fly   630 LKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFEPQVMRIIDNVRPDRQT 694
            |:.|..::|.||||:.||:   :.:|...:.:...||||||.|...||:.|:..:...:.||.|.
  Fly   145 LESGCHVVVGTPGRVYDMI---NRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQV 206

  Fly   695 VMFSATFPRQMEALARRILKKPIEVIVGGRSVVCKEVEQ-HVVILNDDAKFFKLLEL---LGIYQ 755
            ::.|||.|..:..::|..::.|:.::|....:..:.::| :|.:..::.|...|.:|   |.|.|
  Fly   207 ILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQENWKLGTLCDLYDTLSITQ 271

  Fly   756 EAGSIIVFVDKQENADILLRDLMKASYPCMSLHGGIDQFDRDSTIIDFKSGKVRLLIATSVAARG 820
            .    ::|.:.:...|.|.:::...::...::||.::|.||:..:..|:||..|:||.|.:.|||
  Fly   272 S----VIFCNTRRKVDQLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVLITTDLLARG 332

  Fly   821 LDVKDLILVVNYDVPNHYEDYVHRCGRTGRAGKKGSAYTFITPEQSRYAGDIIRAMDLSGTLIPA 885
            :||:.:.||:|||:|::.|:|:||.||.||.|:||.|..|||.:..|...||.:....:...:||
  Fly   333 IDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQFYHTTIEEMPA 397

  Fly   886 ELQAL 890
            .:..|
  Fly   398 NIADL 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6227NP_573020.2 SrmB 482..967 CDD:223587 127/395 (32%)
DEADc 516..719 CDD:238167 69/213 (32%)
HELICc 733..860 CDD:238034 46/130 (35%)
eIF4ANP_001245907.1 PTZ00424 6..403 CDD:185609 127/395 (32%)
DEADc 32..232 CDD:238167 69/211 (33%)
Helicase_C 254..358 CDD:278689 36/107 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451475
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24031
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.