DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6227 and CG31875

DIOPT Version :9

Sequence 1:NP_573020.2 Gene:CG6227 / 32464 FlyBaseID:FBgn0030631 Length:1224 Species:Drosophila melanogaster
Sequence 2:NP_001188765.1 Gene:CG31875 / 318996 FlyBaseID:FBgn0051875 Length:161 Species:Drosophila melanogaster


Alignment Length:104 Identity:25/104 - (24%)
Similarity:35/104 - (33%) Gaps:45/104 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 RRAAAAAPLIIP-----------------LLSTSCSEEEVEEI-----------DKEEQQ----- 187
            |:.||..|..:|                 |.|....:::.:.:           |.||:|     
  Fly    14 RKQAATLPDFVPPWKREQDLQQLQHRASILWSPQLQDQDDKAVREYLDYAASLYDIEEEQALFIL 78

  Fly   188 -----------RRLEQEMIKRRERIERWRAERK-RDTKA 214
                       ||||:....|..|..||:||.. |.|||
  Fly    79 RRHGYDLPLAHRRLEKTETARGCRYHRWKAEDLIRLTKA 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6227NP_573020.2 SrmB 482..967 CDD:223587
DEADc 516..719 CDD:238167
HELICc 733..860 CDD:238034
CG31875NP_001188765.1 ELM2 18..63 CDD:279754 5/44 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0334
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.