DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12608 and Wdr62

DIOPT Version :9

Sequence 1:NP_573019.1 Gene:CG12608 / 32463 FlyBaseID:FBgn0030630 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001259886.1 Gene:Wdr62 / 33367 FlyBaseID:FBgn0031374 Length:2397 Species:Drosophila melanogaster


Alignment Length:469 Identity:97/469 - (20%)
Similarity:157/469 - (33%) Gaps:123/469 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 QTFADS-SHAGSITSVAVQWP---WVASGGTDDRIFVYDMRTRKQSQIILSHAGRVNTLKFTPDL 99
            :||..| |..||:..:::. |   :||:..||..:.|||..:.:....:..|:..|..||||.|.
  Fly   669 KTFKGSHSDEGSLIKLSLD-PSGIYVATSCTDKTLAVYDYYSNECMARMYGHSELVTGLKFTNDC 732

  Fly   100 SHLLSGSDDG---------HMIATRVGSWTKEGDWQKAHAGQA-----VTHISCHPSSKLALSLG 150
            .||:|.|.||         .||.|.....::    |:..:|.|     :..||  |...:.|...
  Fly   733 RHLISASGDGCIFIWQVPHDMIVTMQARMSQ----QRLRSGHAPLPRPLAPIS--PPDGIVLESP 791

  Fly   151 GDQV--------------------LNTWNL-------VNGRVAYKTNLKNKATLGLQPGCLSWSK 188
            ..::                    |..|.:       .:|.::..|.....||:   ||..:.|.
  Fly   792 TSEIEQPQLQPKFGVAERFSDVGQLPQWAMRKAAADSDSGALSIPTPSGGSATV---PGMHAASS 853

  Fly   189 QGD-------HFTLSGPLVLEIWG-----IENAHVMR-RIEMPAKPICITWLDGNECLTGLDNGN 240
            .|:       ..|...|.....|.     :|.|..:| ..|.|...:...   |......:...:
  Fly   854 MGNLSSSPSQQMTGLAPRARGRWAQRSTQLETADDLRSNSESPLGTVSSV---GGHSGVNVQTSD 915

  Fly   241 IAWISLKD---------EDDTPPTFILAHEARVKAIAYLNE-LLATVSSAGEIKVWKIDMETRKL 295
            ....|.||         ||.:..:.:......:|.|...|. .:.||||...|.|          
  Fly   916 YNSASSKDITYNQTYLSEDSSIDSGMETRRGELKFIGSSNNGTVVTVSSVSSIAV---------- 970

  Fly   296 EEIASSFMDCRPTDLGLLDLRQFGNVQPVEQRIK---------------VEE-KPKAKVESD--- 341
                |:......|..|....|    :|..::|:|               ||: ....:..||   
  Fly   971 ----SASNGAMSTGSGAAQQR----LQLPDKRLKPGLRFDTHTHDHDGDVEDISDGERTSSDHGM 1027

  Fly   342 --QSAKPAAPRGFVTIEYEQDKNLDAEKKKGKGKKNKIQAKKAQQKAEESSEESNSSEEKESDDF 404
              .:..|:.|..|......:|: |....::.|.:|:.:|...:......||.  .:|....:.|.
  Fly  1028 FYNNLAPSTPTDFKVTAMNEDE-LRKSVRRQKFEKSGLQLTPSALSGNGSSH--TASTGTGTSDT 1089

  Fly   405 SDSDSDVSSDHGHR 418
            .|..|..|:::..|
  Fly  1090 EDEGSTPSAENAER 1103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12608NP_573019.1 WD40 33..>289 CDD:225201 70/317 (22%)
WD40 45..295 CDD:295369 67/316 (21%)
WD40 repeat 51..85 CDD:293791 8/36 (22%)
WD40 repeat 90..128 CDD:293791 16/46 (35%)
WD40 repeat 135..170 CDD:293791 7/61 (11%)
WD40 repeat 181..214 CDD:293791 10/45 (22%)
WD40 repeat 264..286 CDD:293791 8/22 (36%)
Wdr62NP_001259886.1 WD40 73..448 CDD:295369
WD40 repeat 73..107 CDD:293791
WD40 repeat 113..161 CDD:293791
WD40 158..574 CDD:225201
WD40 repeat 167..207 CDD:293791
WD40 repeat 209..285 CDD:293791
WD40 repeat 254..294 CDD:293791
WD40 repeat 303..338 CDD:293791
WD40 repeat 353..407 CDD:293791
WD40 385..747 CDD:225201 27/78 (35%)
WD40 436..748 CDD:295369 27/79 (34%)
WD40 repeat 505..540 CDD:293791
WD40 repeat 546..586 CDD:293791
WD40 repeat 591..631 CDD:293791
WD40 repeat 637..672 CDD:293791 1/2 (50%)
WD40 repeat 679..717 CDD:293791 10/38 (26%)
WD40 repeat 723..749 CDD:293791 12/25 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442340
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.