DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12608 and CG3436

DIOPT Version :9

Sequence 1:NP_573019.1 Gene:CG12608 / 32463 FlyBaseID:FBgn0030630 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001285543.1 Gene:CG3436 / 33180 FlyBaseID:FBgn0031229 Length:347 Species:Drosophila melanogaster


Alignment Length:262 Identity:51/262 - (19%)
Similarity:89/262 - (33%) Gaps:81/262 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 HAGSITSVAV--QWPWVASGGTDDRIFVYDMRTRKQSQIILS-HAGRVNTLKFTPDLSHLLSGSD 107
            |.|.|.:...  :...:.|.|.|.:|:::.:....::.:.:| |:|.|....||||.||:.:.|.
  Fly    54 HEGEIFTAEFHPEGELLLSSGFDRQIYIWQVYEDCENVMAMSGHSGAVMEAHFTPDGSHIFTCST 118

  Fly   108 DGHM----IATRVGSWTKEGDWQKAHAGQAVTHISCHPSSKLALSLGGDQVLNTWNLVNGRVAYK 168
            |..:    |||        |..|:...|..                         |.||.     
  Fly   119 DKTLAFWDIAT--------GQRQRRFKGHG-------------------------NFVNS----- 145

  Fly   169 TNLKNKATLGLQPGCLSWSKQGDHFTLSG--PLVLEIWGIENAHVMRRIEMPAKPICITWLD-GN 230
                           :..|::|.....||  ...::||.....|....:|.|.:...:.:.| |.
  Fly   146 ---------------VQGSRRGQQLLCSGSDDRTIKIWDARKKHAAHTLESPFQVTAVCFGDTGE 195

  Fly   231 ECLT-GLDNGNIAW--------ISLKDEDDTPPTFILAHEARVKAIAYLNELLATVSSAGEIKVW 286
            :.:: |:||....|        ..|:...||.....|:.|         .:.:.|.:....::||
  Fly   196 QVISGGIDNEVKIWDIRKQAVLHHLRGHSDTITGMSLSPE---------GDFILTNAMDNTLRVW 251

  Fly   287 KI 288
            .:
  Fly   252 DV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12608NP_573019.1 WD40 33..>289 CDD:225201 51/262 (19%)
WD40 45..295 CDD:295369 51/262 (19%)
WD40 repeat 51..85 CDD:293791 4/35 (11%)
WD40 repeat 90..128 CDD:293791 14/41 (34%)
WD40 repeat 135..170 CDD:293791 3/34 (9%)
WD40 repeat 181..214 CDD:293791 7/34 (21%)
WD40 repeat 264..286 CDD:293791 1/21 (5%)
CG3436NP_001285543.1 WD40 <19..346 CDD:225201 51/262 (19%)
WD40 50..342 CDD:238121 51/262 (19%)
WD40 repeat 58..96 CDD:293791 5/37 (14%)
WD40 repeat 102..138 CDD:293791 13/43 (30%)
WD40 repeat 143..180 CDD:293791 9/56 (16%)
WD40 repeat 186..221 CDD:293791 6/34 (18%)
WD40 repeat 227..267 CDD:293791 5/36 (14%)
WD40 repeat 277..313 CDD:293791
WD40 repeat 319..342 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442321
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.