DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12608 and CG9123

DIOPT Version :9

Sequence 1:NP_573019.1 Gene:CG12608 / 32463 FlyBaseID:FBgn0030630 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_573018.1 Gene:CG9123 / 32462 FlyBaseID:FBgn0030629 Length:434 Species:Drosophila melanogaster


Alignment Length:443 Identity:403/443 - (90%)
Similarity:414/443 - (93%) Gaps:9/443 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPPEMEIIVGTYEEVLLGFKLIKSPTDGLTDSVKFELKQTFADSSHAGSITSVAVQWPWVASGGT 65
            ||||||||..|.||:|||||||||||||.||||||||||||||||:|.||||:||||||||||||
  Fly     1 MPPEMEIIEATNEELLLGFKLIKSPTDGFTDSVKFELKQTFADSSYARSITSLAVQWPWVASGGT 65

  Fly    66 DDRIFVYDMRTRKQSQIILSHAGRVNTLKFTPDLSHLLSGSDDGHMIATRVGSWTKEGDWQKAHA 130
            |.|||||||||||||||||||||||||||||||||.|||||||||||||||||||||.|||||||
  Fly    66 DGRIFVYDMRTRKQSQIILSHAGRVNTLKFTPDLSLLLSGSDDGHMIATRVGSWTKEYDWQKAHA 130

  Fly   131 GQAVTHISCHPSSKLALSLGGDQVLNTWNLVNGRVAYKTNLKNKATLGLQPGCLSWSKQGDHFTL 195
            ||||||:||||||||||||||||||||||||||.||:||||||||||..|.||||||||||||||
  Fly   131 GQAVTHVSCHPSSKLALSLGGDQVLNTWNLVNGCVAHKTNLKNKATLDFQTGCLSWSKQGDHFTL 195

  Fly   196 SGPLVLEIWGIENAHVMRRIEMPAKPICITWLDGNECLTGLDNGNIAWISLKDEDDTPPTFILAH 260
            |||||||||||||||||||||||:|||||||||||||||||||||||||||||||||||||||||
  Fly   196 SGPLVLEIWGIENAHVMRRIEMPSKPICITWLDGNECLTGLDNGNIAWISLKDEDDTPPTFILAH 260

  Fly   261 EARVKAIAYLNELLATVSSAGEIKVWKIDMETRKLEEIASSFMDCRPTDLGLLDLRQFGNVQPVE 325
            |.||||||||||.|||||.||:|||||||||||||||||.|||||||||||||||||||||:|||
  Fly   261 EVRVKAIAYLNEFLATVSIAGQIKVWKIDMETRKLEEIARSFMDCRPTDLGLLDLRQFGNVRPVE 325

  Fly   326 QRIKVEEKPKAKVESDQSAKPAAPRGFVTIEYEQDKNLDAEKKKGKGKKNKIQAKKAQQKAEESS 390
            ||.|||||||||||||||||||||||||||||||||.|||||||.| ||||        |.||||
  Fly   326 QRTKVEEKPKAKVESDQSAKPAAPRGFVTIEYEQDKKLDAEKKKEK-KKNK--------KDEESS 381

  Fly   391 EESNSSEEKESDDFSDSDSDVSSDHGHRKRKPMKRKQQPTPASKGKAKQQKKK 443
            |||||||:||:||||||||||||||||||||||||:|||||||||||||||||
  Fly   382 EESNSSEDKENDDFSDSDSDVSSDHGHRKRKPMKREQQPTPASKGKAKQQKKK 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12608NP_573019.1 WD40 33..>289 CDD:225201 238/255 (93%)
WD40 45..295 CDD:295369 232/249 (93%)
WD40 repeat 51..85 CDD:293791 31/33 (94%)
WD40 repeat 90..128 CDD:293791 35/37 (95%)
WD40 repeat 135..170 CDD:293791 31/34 (91%)
WD40 repeat 181..214 CDD:293791 31/32 (97%)
WD40 repeat 264..286 CDD:293791 18/21 (86%)
CG9123NP_573018.1 WD40 49..295 CDD:295369 230/245 (94%)
WD40 repeat 50..85 CDD:293791 32/34 (94%)
WD40 <60..294 CDD:225201 219/233 (94%)
WD40 repeat 91..129 CDD:293791 35/37 (95%)
WD40 repeat 134..170 CDD:293791 32/35 (91%)
WD40 repeat 178..216 CDD:293791 34/37 (92%)
WD40 repeat 222..257 CDD:293791 34/34 (100%)
WD40 repeat 264..288 CDD:293791 20/23 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I4700
eggNOG 1 0.900 - - E1_KOG0294
Homologene 1 1.000 - - H39574
Inparanoid 1 1.050 97 1.000 Inparanoid score I2208
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D537718at33208
OrthoFinder 1 1.000 - - FOG0005831
OrthoInspector 1 1.000 - - otm26090
orthoMCL 1 0.900 - - OOG6_103104
Panther 1 1.100 - - P PTHR44675
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1339
SonicParanoid 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.