DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12608 and Rbcn-3B

DIOPT Version :9

Sequence 1:NP_573019.1 Gene:CG12608 / 32463 FlyBaseID:FBgn0030630 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001284797.1 Gene:Rbcn-3B / 31155 FlyBaseID:FBgn0023510 Length:1525 Species:Drosophila melanogaster


Alignment Length:485 Identity:97/485 - (20%)
Similarity:155/485 - (31%) Gaps:169/485 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPPEMEIIVGTYEEVLLGFKLIKSPTDGLTDSVKFELKQTFADSSHAGSITSVAVQWPWVASGGT 65
            :|.:..:::|..:    |..:|...|..:...:...:||.|:|             ||       
  Fly   412 LPQQSRLVIGRED----GSIVIVPATQTVMMQLLVGIKQNFSD-------------WP------- 452

  Fly    66 DDRIFVYDMRTRKQSQIILSHAGRVNTLKFTPDL-------SHLLSGSDDGHMIATRVGSWTKEG 123
                         ..||:..|.||||.| ..|.:       ||||||..|..:..          
  Fly   453 -------------SHQILYGHRGRVNCL-LCPSMIHSRYEKSHLLSGGIDFAVCL---------- 493

  Fly   124 DWQK----------AHAGQAVTHI-----SCHPS-SKLALSLGGDQVLNTWNLVNGR--VAYKTN 170
             |..          .|||: :|.:     ||.|. .|...|:..|..:...:|...:  .....:
  Fly   494 -WDLYSGSLLHRFCVHAGE-ITQLLVPPESCSPRILKCICSVASDHSVTLVSLQERKCVTLASRH 556

  Fly   171 LKNKATLGLQP-------GCLS-----WSKQGDHF--TLSGPLVLEI------------------ 203
            |....|:..:|       ||..     |..:..|.  .|.|.|..|:                  
  Fly   557 LFPVVTIKWRPLDDFLIVGCSDGSVYVWQMETGHLDRVLHGMLAEEVLSACDEQAEDGGSGGGGG 621

  Fly   204 --------WGIEN--AHVMRRIE-------MPAKPICITWLDGNECLTGLDNGNIAWISLKDEDD 251
                    .|:.|  .|..|.::       ..|....||.|   :.|.|.:.||.          
  Fly   622 SNGASASEMGMANPAVHFFRGLKSRNMNAIRHATQRGITQL---QQLQGHNQGNF---------- 673

  Fly   252 TPPTFILAHEARVKAIAYLNELLATVSSAGEIKVWKIDMETRKLEEIASSFMDCRPTDLGLLDLR 316
               .|::.|.:....|    :.|.|.....|..:...|:|....|..:..:....|..|..|.:.
  Fly   674 ---DFLMKHRSNPLVI----QGLRTNPKDAESHILFFDIEGLIFELHSEEYAQMTPATLESLGVH 731

  Fly   317 ----QFGNVQPVEQRIKVEE-----KPKAKVESDQSAKPAAPRGFVTIEYEQDKNLDAEKKKGKG 372
                :.|....::...|:.:     |.|| |:.::..|            ::||:...:|.|.|.
  Fly   732 LQNPKDGKSMHLDASKKIGDFFNKVKNKA-VDVEKILK------------DKDKHGLVQKFKEKT 783

  Fly   373 K--KNKIQAK-KAQQKAEESSEESNSSEEK 399
            :  :.|:||| ::.|||.|..||....:.|
  Fly   784 EIVEKKVQAKVESLQKAVEPHEEQQDLKSK 813

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12608NP_573019.1 WD40 33..>289 CDD:225201 63/329 (19%)
WD40 45..295 CDD:295369 61/323 (19%)
WD40 repeat 51..85 CDD:293791 4/33 (12%)
WD40 repeat 90..128 CDD:293791 12/54 (22%)
WD40 repeat 135..170 CDD:293791 8/42 (19%)
WD40 repeat 181..214 CDD:293791 12/74 (16%)
WD40 repeat 264..286 CDD:293791 4/21 (19%)
Rbcn-3BNP_001284797.1 WD40 <11..>204 CDD:225201
WD40 repeat 20..63 CDD:293791
WD40 <22..202 CDD:295369
WD40 repeat 68..107 CDD:293791
WD40 repeat 118..152 CDD:293791
WD40 repeat 160..204 CDD:293791
WD40 repeat 212..251 CDD:293791
WD40 repeat 406..459 CDD:293791 13/83 (16%)
WD40 <449..>607 CDD:225201 42/203 (21%)
WD40 453..>597 CDD:295369 36/156 (23%)
WD40 repeat 513..555 CDD:293791 8/41 (20%)
WD40 repeat 560..596 CDD:293791 6/35 (17%)
WD40 <1395..>1469 CDD:225201
WD40 <1399..1495 CDD:295369
WD40 repeat 1439..1466 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442343
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.