DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12608 and wdr-5.3

DIOPT Version :9

Sequence 1:NP_573019.1 Gene:CG12608 / 32463 FlyBaseID:FBgn0030630 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001024299.1 Gene:wdr-5.3 / 179489 WormBaseID:WBGene00013862 Length:501 Species:Caenorhabditis elegans


Alignment Length:374 Identity:74/374 - (19%)
Similarity:119/374 - (31%) Gaps:147/374 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LIKSPTDGLTDSVKFELKQTFADSSHAGSITSVAVQW--PWVASGGTDDRIFVYDMRTRKQSQII 83
            :.|.|.:|     :|.|.:|.  |.|..|::.:...:  .::.:|..|.:|.|::.......|.:
 Worm   194 ITKKPENG-----EFSLVKTI--SGHTKSVSVIKFSYCGKYLGTGSADKQIKVWNTVDMTYLQTL 251

  Fly    84 LSHAGRVNTLKFTPDLSHLLSGSDD----------GHMIATRVGSWTKEGDWQKAHAGQAVTHIS 138
            .||...:|...::.:...:.|.|||          |..:.|..|.               ..::.
 Worm   252 ASHQLGINDFSWSSNSQFIASASDDTTVKIFDVISGACLRTMRGH---------------TNYVF 301

  Fly   139 C---HPSSKLALSLGGDQVLNTWNLVNGRVAYKTNLKNKATLGLQPGCLSWSKQGDHFTLSGPLV 200
            |   :|.|.|..|.|.|:.:..|:       :||        ||...|:                
 Worm   302 CCSFNPQSSLIASAGFDETVRVWD-------FKT--------GLCVKCI---------------- 335

  Fly   201 LEIWGIENAHVMRRIEMPAKPICITWL----DGNECLTGLDNGNI-AW--------ISLKDEDDT 252
                             ||....||.:    |||...|...:|.| .|        .:|.|.|..
 Worm   336 -----------------PAHSDPITSISYNHDGNTMATSSYDGCIRVWDAASGSCLKTLVDTDHA 383

  Fly   253 PPTFI-------------------LAHEARVKAIAYLNE-------LLATV-----------SSA 280
            |.||:                   |....:.|.:.|.|.       |.|.:           |..
 Worm   384 PVTFVCFSPNGKYLLSAQLDSSLKLWDPKKAKPLKYYNGHKNKKYCLFANMSVPLGKHIISGSED 448

  Fly   281 GEIKVWKIDMETRKLEEIASSF------MDCRPTDLGLLDLRQFGNVQP 323
            |.|.||.|  :|:::.:|....      .|..||    |::...|.::|
 Worm   449 GRILVWSI--QTKQIVQILEGHTTPVLATDSHPT----LNIIASGGLEP 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12608NP_573019.1 WD40 33..>289 CDD:225201 62/320 (19%)
WD40 45..295 CDD:295369 60/314 (19%)
WD40 repeat 51..85 CDD:293791 5/35 (14%)
WD40 repeat 90..128 CDD:293791 8/47 (17%)
WD40 repeat 135..170 CDD:293791 9/37 (24%)
WD40 repeat 181..214 CDD:293791 1/32 (3%)
WD40 repeat 264..286 CDD:293791 8/39 (21%)
wdr-5.3NP_001024299.1 WD40 <200..501 CDD:225201 72/368 (20%)
WD40 205..499 CDD:238121 70/358 (20%)
WD40 repeat 216..253 CDD:293791 5/36 (14%)
WD40 repeat 259..295 CDD:293791 7/35 (20%)
WD40 repeat 300..336 CDD:293791 13/83 (16%)
WD40 repeat 343..378 CDD:293791 8/34 (24%)
WD40 repeat 385..421 CDD:293791 5/35 (14%)
WD40 repeat 429..466 CDD:293791 10/38 (26%)
WD40 repeat 472..498 CDD:293791 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157518
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.