DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12608 and wdr-5.1

DIOPT Version :9

Sequence 1:NP_573019.1 Gene:CG12608 / 32463 FlyBaseID:FBgn0030630 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_497749.1 Gene:wdr-5.1 / 175474 WormBaseID:WBGene00006474 Length:376 Species:Caenorhabditis elegans


Alignment Length:243 Identity:51/243 - (20%)
Similarity:95/243 - (39%) Gaps:51/243 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EEVLLGFKL-------------IKSPTDGLT----DSVKFELKQTFADSSHAGSITSVAVQWPWV 60
            |..|.|.||             :.|.:|..|    :.|...:.:|....::.....:...|...|
 Worm   122 ERTLTGHKLGVNDIAWSSDSRCVVSASDDKTLKIFEIVTSRMTKTLKGHNNYVFCCNFNPQSSLV 186

  Fly    61 ASGGTDDRIFVYDMRTRKQSQIILSHAGRVNTLKFTPDLSHLLSGSDDGHMIATRVGSWTKEGDW 125
            .||..|:.:.::|::|....:.:.:|:..|:.:.|..|.|.:.|||.||   ..|:        |
 Worm   187 VSGSFDESVRIWDVKTGMCIKTLPAHSDPVSAVSFNRDGSLIASGSYDG---LVRI--------W 240

  Fly   126 QKAHAGQA-----------VTHISCHPSSKLALSLGGDQVLNTWNLVNGRVAYK-TNLKNKATLG 178
            ..|: ||.           |..:...|:.|..|:...|..|..|:...|:...: |..:|...  
 Worm   241 DTAN-GQCIKTLVDDENPPVAFVKFSPNGKYILASNLDSTLKLWDFSKGKTLKQYTGHENSKY-- 302

  Fly   179 LQPGCL--SWSKQGDHFTLSG--PLVLEIWGIENAHVMRRIEMPAKPI 222
                |:  ::|..|..:.:||  ...:.||.::...:::.:|...:|:
 Worm   303 ----CIFANFSVTGGKWIISGSEDCKIYIWNLQTREIVQCLEGHTQPV 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12608NP_573019.1 WD40 33..>289 CDD:225201 43/206 (21%)
WD40 45..295 CDD:295369 41/194 (21%)
WD40 repeat 51..85 CDD:293791 7/33 (21%)
WD40 repeat 90..128 CDD:293791 11/37 (30%)
WD40 repeat 135..170 CDD:293791 7/35 (20%)
WD40 repeat 181..214 CDD:293791 7/36 (19%)
WD40 repeat 264..286 CDD:293791
wdr-5.1NP_497749.1 WD40 <76..372 CDD:225201 51/243 (21%)
WD40 79..373 CDD:238121 51/243 (21%)
WD40 repeat 90..127 CDD:293791 2/4 (50%)
WD40 repeat 133..169 CDD:293791 5/35 (14%)
WD40 repeat 174..210 CDD:293791 7/35 (20%)
WD40 repeat 217..252 CDD:293791 13/46 (28%)
WD40 repeat 259..295 CDD:293791 8/35 (23%)
WD40 repeat 303..340 CDD:293791 7/36 (19%)
WD40 repeat 346..372 CDD:293791 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157517
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.