DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9123 and PAK1IP1

DIOPT Version :9

Sequence 1:NP_573018.1 Gene:CG9123 / 32462 FlyBaseID:FBgn0030629 Length:434 Species:Drosophila melanogaster
Sequence 2:XP_011513022.1 Gene:PAK1IP1 / 55003 HGNCID:20882 Length:415 Species:Homo sapiens


Alignment Length:423 Identity:105/423 - (24%)
Similarity:181/423 - (42%) Gaps:86/423 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KFELKQTFADSSYARSITSLAVQWPWVASGGTDGRIFVYDMRTRKQSQIILSHAGRVNTLKFTPD 98
            ::.|...|...::..|::::||...:|.:|..|..|.:|||:.:.:...::.|:|.:..|||..:
Human    52 QWTLVADFTHHAHTASLSAVAVNSRFVVTGSKDETIHIYDMKKKIEHGALVHHSGTITCLKFYGN 116

  Fly    99 LSLLLSGSDDGHMIATRVGSWTKEYDWQ-----KAHAGQAVTHVSCHPSSKLALSLGGDQVLNTW 158
            .. |:||::||     .:..|..: .|:     |||.|| ||.:|.|||.|||||:|.|:.|.||
Human   117 RH-LISGAEDG-----LICIWDAK-KWECLKSIKAHKGQ-VTFLSIHPSGKLALSVGTDKTLRTW 173

  Fly   159 NLVNGCVAHKTNLKNKATLDFQTGCLSWSKQGDHFTLSGPLVLEIWGIENAHVMRRIEMPSKPIC 223
            |||.|..|...|:|..|.:      :.||.:|:.:.:.....::|:.::.|.:...|....:...
Human   174 NLVEGRSAFIKNIKQNAHI------VEWSPRGEQYVVIIQNKIDIYQLDTASISGTITNEKRISS 232

  Fly   224 ITWLDGNECLTGLDNGNIAWISLKDEDDTPPTFIL----AHEVRVKAIAYL----NEFLATVSIA 280
            :.:|..:......|...|.:.      |......|    |||.|||.:...    :..:.:.|..
Human   233 VKFLSESVLAVAGDEEVIRFF------DCDSLVCLCEFKAHENRVKDMFSFEIPEHHVIVSASSD 291

  Fly   281 GQIKVWKIDMETRKLEEIARSFM-----DCRPTDLGL-LDLRQFGNVRPVEQRTKVEEKPKAKVE 339
            |.||:||:..:    :::..|.:     :.|.|.||: ||              ||       .:
Human   292 GFIKMWKLKQD----KKVPPSLLCEINTNARLTCLGVWLD--------------KV-------AD 331

  Fly   340 SDQSAKPAAPRGFVTIEYEQDKKLDAEKKKEKKKNKKDEESSEESNSSEDKENDDFSDSDSDVSS 404
            ..:|..|||          :...:..|:.|..||...|....||..|..:.:....:......:.
Human   332 MKESLPPAA----------EPSPVSKEQSKIGKKEPGDTVHKEEKRSKPNTKKRGLTGDSKKATK 386

  Fly   405 DHG---HRKRKPMKREQQPTPASKGKAKQQKKK 434
            :.|   .:|||.::..::         |::|||
Human   387 ESGLISTKKRKMVEMLEK---------KRKKKK 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9123NP_573018.1 WD40 49..295 CDD:295369 74/258 (29%)
WD40 repeat 50..85 CDD:293791 9/34 (26%)
WD40 <60..294 CDD:225201 71/246 (29%)
WD40 repeat 91..129 CDD:293791 11/42 (26%)
WD40 repeat 134..170 CDD:293791 21/35 (60%)
WD40 repeat 178..216 CDD:293791 5/37 (14%)
WD40 repeat 222..257 CDD:293791 4/34 (12%)
WD40 repeat 264..288 CDD:293791 7/27 (26%)
PAK1IP1XP_011513022.1 WD40 <60..300 CDD:225201 74/259 (29%)
WD40 64..298 CDD:295369 72/253 (28%)
WD40 repeat 68..103 CDD:293791 9/34 (26%)
WD40 repeat 109..144 CDD:293791 10/41 (24%)
WD40 repeat 149..185 CDD:293791 21/35 (60%)
WD40 repeat 193..223 CDD:293791 5/29 (17%)
WD40 repeat 230..265 CDD:293791 5/40 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0294
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H39574
Inparanoid 1 1.050 132 1.000 Inparanoid score I4620
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59992
OrthoDB 1 1.010 - - D537718at33208
OrthoFinder 1 1.000 - - FOG0005831
OrthoInspector 1 1.000 - - otm40510
orthoMCL 1 0.900 - - OOG6_103104
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1339
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.770

Return to query results.
Submit another query.