DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9123 and Prp19

DIOPT Version :9

Sequence 1:NP_573018.1 Gene:CG9123 / 32462 FlyBaseID:FBgn0030629 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_523783.1 Gene:Prp19 / 37123 FlyBaseID:FBgn0261119 Length:505 Species:Drosophila melanogaster


Alignment Length:325 Identity:61/325 - (18%)
Similarity:118/325 - (36%) Gaps:86/325 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TDSVKFELKQTFADSSYARSITSL------AVQWPWVASGGTDGRIFVYDMRTRKQSQIILSHAG 88
            ||.||..|........::.|:..:      :.....:.:||.|....|::..|.:...|:..|..
  Fly   202 TDQVKNFLTVASHPGLHSASVPGILALDINSADHSKILTGGNDKNATVFNKDTEQMVAILKGHTK 266

  Fly    89 RVNTLKFTPDLSLLLSGSDDGHMIATRVGSWTKEYDWQ----------KAHAGQAVTHVSCHPSS 143
            ::..:.:.|:...:::||.|.::   |:        |.          :.|.| .||.:|.||:.
  Fly   267 KITKVIYHPNEDTVITGSPDMNI---RI--------WHVPTSQTQLLLRCHEG-PVTGLSLHPTG 319

  Fly   144 KLALSLGGD---------------QVLNTW------------NLVNGCVAHKTNLK--------N 173
            ...||...|               :|::|.            .|:.|.....:.:|        |
  Fly   320 DYLLSTSSDKHWAFSDIRTGRLLTKVIDTAEVGLTTAQFHPDGLIFGTGTVDSQVKIWDLKEQSN 384

  Fly   174 KATLDFQTG---CLSWSKQGDHF-TLSGPLVLEIWGIENAHVMRRIEMPS----KPICITWLDGN 230
            .|.....||   .:|:|:.|.:. |.:....:::|.:......:.|::..    |.:|   .|.:
  Fly   385 VANFPGHTGPISAISFSENGYYLATAADDACVKLWDLRKLKNFKTIQLDDGYEVKDLC---FDQS 446

  Fly   231 ECLTGLDNGNI------AWISLKDEDDTPPTFILAHEVRVKAIAYLNEFLATVSIAGQIKVWKID 289
            .....:...::      .|..||..:|..   .||..||....|   ::||:.|:...:|::.|:
  Fly   447 GTYLAIAGSDVRVYLCKQWQELKVFNDHT---ALATGVRFGKHA---QYLASTSMDRTLKLYAIE 505

  Fly   290  289
              Fly   506  505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9123NP_573018.1 WD40 49..295 CDD:295369 56/306 (18%)
WD40 repeat 50..85 CDD:293791 6/40 (15%)
WD40 <60..294 CDD:225201 55/289 (19%)
WD40 repeat 91..129 CDD:293791 6/47 (13%)
WD40 repeat 134..170 CDD:293791 12/62 (19%)
WD40 repeat 178..216 CDD:293791 7/41 (17%)
WD40 repeat 222..257 CDD:293791 6/40 (15%)
WD40 repeat 264..288 CDD:293791 5/23 (22%)
Prp19NP_523783.1 Ubox 2..68 CDD:128780
Prp19 69..132 CDD:285771
WD40 210..503 CDD:238121 55/313 (18%)
WD40 <225..505 CDD:225201 54/300 (18%)
WD40 repeat 269..305 CDD:293791 6/46 (13%)
WD40 repeat 310..345 CDD:293791 8/34 (24%)
WD40 repeat 354..389 CDD:293791 5/34 (15%)
WD40 repeat 395..431 CDD:293791 5/35 (14%)
WD40 repeat 438..484 CDD:293791 11/51 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470268
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.