DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9123 and Pak1ip1

DIOPT Version :9

Sequence 1:NP_573018.1 Gene:CG9123 / 32462 FlyBaseID:FBgn0030629 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001032433.1 Gene:Pak1ip1 / 361232 RGDID:1565353 Length:382 Species:Rattus norvegicus


Alignment Length:457 Identity:119/457 - (26%)
Similarity:194/457 - (42%) Gaps:103/457 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MEIIEATNEELLLGFKLIKSPTDGFTDSVKFELKQT------FADSSYARSITSLAVQWPWVASG 63
            ||::..:.|::|.||.:.:.|       .|...::|      |...::..|::::|....:|.:|
  Rat     1 MELVAGSYEQVLFGFTVHRGP-------AKSGHRETWTPVADFTHHAHTASLSAVAANNRYVVTG 58

  Fly    64 GTDGRIFVYDMRTRKQSQIILSHAGRVNTLKFTPDLSLLLSGSDDGHMIATRVGSWTKEYDWQ-- 126
            ..|..|.:|||:.:.:...::.|:|.|..|||..... |:||::||.:..     |..: .|:  
  Rat    59 SKDETIHIYDMKKKVEHGALVHHSGTVTCLKFYGSRH-LISGAEDGLICV-----WDAK-KWECL 116

  Fly   127 ---KAHAGQAVTHVSCHPSSKLALSLGGDQVLNTWNLVNGCVAHKTNLKNKATLDFQTGCLSWSK 188
               |||.|. ||.:|.|||.|||||:|.|:.|.|||||.|..|...|:|..|.:      :.||.
  Rat   117 KSIKAHRGH-VTFLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKQNAHI------VEWSP 174

  Fly   189 QGDHFTLSGPLVLEIWGIENAHVMRRIEMPSKPICITWLDGNECLTGLDNGNIAWISLKDEDDTP 253
            .|:.:.:.....::::.::.|.|...:....:...||:|..:......|...:.:.   |.|   
  Rat   175 NGEKYVVVVMNKVDVYHLDTASVSGTLTNGKRISAITFLSDSVLAVAGDEEVVRFF---DCD--- 233

  Fly   254 PTFIL-----AHEVRVKAIAYL----NEFLATVSIAGQIKVWKIDMETRKLEE-IARSFMDCRPT 308
             |.:.     |||.|||.:...    :..|.|.|..|.||:|.:..:.:.... :..:....|.|
  Rat   234 -TLVCLCEFKAHENRVKDMVSFEIPDHHVLVTASNDGFIKMWTLTQDKKAPPSLLCETNTGARLT 297

  Fly   309 DLGL-LDLRQFGNVRPVEQRTKVEEKPKAKVESDQSAKPAAPRGFVTIEYEQDKKLDAEKKKEKK 372
            .||: ||       |..::        ||::.......|..|:   |||.|              
  Rat   298 CLGVWLD-------RGTDE--------KARLPPATEPCPDQPK---TIEKE-------------- 330

  Fly   373 KNKKDEESSEESNSSEDKENDDFSDSDSDVSSDHGHRKRKPMKREQQPTPASKGK-----AKQQK 432
                          |.||..::.|..::: .|||....::|.|| ..|.||.|.|     .|::|
  Rat   331 --------------SADKIQEEASAPNAE-KSDHTGGSQQPTKR-NSPAPAKKRKMANVSEKKRK 379

  Fly   433 KK 434
            ||
  Rat   380 KK 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9123NP_573018.1 WD40 49..295 CDD:295369 75/259 (29%)
WD40 repeat 50..85 CDD:293791 8/34 (24%)
WD40 <60..294 CDD:225201 73/247 (30%)
WD40 repeat 91..129 CDD:293791 11/42 (26%)
WD40 repeat 134..170 CDD:293791 21/35 (60%)
WD40 repeat 178..216 CDD:293791 5/37 (14%)
WD40 repeat 222..257 CDD:293791 7/34 (21%)
WD40 repeat 264..288 CDD:293791 9/27 (33%)
Pak1ip1NP_001032433.1 WD40 <37..274 CDD:225201 74/257 (29%)
WD40 41..274 CDD:295369 74/253 (29%)
WD40 repeat 45..80 CDD:293791 8/34 (24%)
WD40 repeat 86..121 CDD:293791 10/41 (24%)
WD40 repeat 126..162 CDD:293791 21/35 (60%)
WD40 repeat 207..242 CDD:293791 7/41 (17%)
WD40 repeat 250..291 CDD:293791 7/40 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0294
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H39574
Inparanoid 1 1.050 129 1.000 Inparanoid score I4554
OMA 1 1.010 - - QHG59992
OrthoDB 1 1.010 - - D537718at33208
OrthoFinder 1 1.000 - - FOG0005831
OrthoInspector 1 1.000 - - otm44652
orthoMCL 1 0.900 - - OOG6_103104
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.740

Return to query results.
Submit another query.