Sequence 1: | NP_001259569.1 | Gene: | HDAC6 / 32461 | FlyBaseID: | FBgn0026428 | Length: | 1179 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_010161.1 | Gene: | UBP1 / 851435 | SGDID: | S000002280 | Length: | 809 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 259 | Identity: | 51/259 - (19%) |
---|---|---|---|
Similarity: | 78/259 - (30%) | Gaps: | 92/259 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 415 GAALTLRSLLGD-PCPPLVETVPLPRAELAQALLSCIAVHRPHWRCLQLQQTYDCVELQDRDKEE 478
Fly 479 DLHTVLRHWIGGPPPMDRYPTRDTAIPLPPEKLTSNAARLQVLRAETKLSVP-----SFKVCYAY 538
Fly 539 DAQMLLHCNLNDTGHPEQPSRIQHIH-------------KMHDDYGLLKQMKQLSPRAATTDEVC 590
Fly 591 L--------------------------AHTRAHVNTVRRLL-GREPKELHDAAGIYNSVYLHPR 627 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
HDAC6 | NP_001259569.1 | HDAC10_HDAC6-dom1 | 119..457 | CDD:212526 | 12/42 (29%) |
HDAC6-dom2 | 538..895 | CDD:212527 | 24/130 (18%) | ||
zf-UBP | 1007..1069 | CDD:280334 | |||
UBP1 | NP_010161.1 | Peptidase_C19 | 101..>293 | CDD:351799 | |
Peptidase_C19F | 102..736 | CDD:239127 | 51/259 (20%) | ||
Peptidase_C19 | <427..>510 | CDD:351799 | 14/84 (17%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1867 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |