DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC6 and UBP1

DIOPT Version :9

Sequence 1:NP_001259569.1 Gene:HDAC6 / 32461 FlyBaseID:FBgn0026428 Length:1179 Species:Drosophila melanogaster
Sequence 2:NP_010161.1 Gene:UBP1 / 851435 SGDID:S000002280 Length:809 Species:Saccharomyces cerevisiae


Alignment Length:259 Identity:51/259 - (19%)
Similarity:78/259 - (30%) Gaps:92/259 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   415 GAALTLRSLLGD-PCPPLVETVPLPRAELAQALLSCIAVHRPHWRCLQLQQTYDCVELQDRDKEE 478
            |:.|.|..||.| ..|.::|.|...|..|..|                                 
Yeast   364 GSTLKLSQLLSDWSKPEIIEGVECNRCALTAA--------------------------------- 395

  Fly   479 DLHTVLRHWIGGPPPMDRYPTRDTAIPLPPEKLTSNAARLQVLRAETKLSVP-----SFKVCYAY 538
              |:   |..|.....::.|....     ||||. ||.:.:|.:.|..|:.|     .:|..:. 
Yeast   396 --HS---HLFGQLKEFEKKPEGSI-----PEKLI-NAVKDRVHQIEEVLAKPVIDDEDYKKLHT- 448

  Fly   539 DAQMLLHCNLNDTGHPEQPSRIQHIH-------------KMHDDYGLLKQMKQLSPRAATTDEVC 590
             |.|:..|:.:......:|..:..||             :.::...|.|....|:|.....:|:.
Yeast   449 -ANMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLFKSRLNLAPWCCDINEIN 512

  Fly   591 L--------------------------AHTRAHVNTVRRLL-GREPKELHDAAGIYNSVYLHPR 627
            |                          .:|:.|....:... ..|.||..||.|.|.|.|.|.:
Yeast   513 LDARLPMSKKEKAAQQDSSEDENIGGEYYTKLHERFEQEFEDSEEEKEYDDAEGNYASHYNHTK 576

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC6NP_001259569.1 HDAC10_HDAC6-dom1 119..457 CDD:212526 12/42 (29%)
HDAC6-dom2 538..895 CDD:212527 24/130 (18%)
zf-UBP 1007..1069 CDD:280334
UBP1NP_010161.1 Peptidase_C19 101..>293 CDD:351799
Peptidase_C19F 102..736 CDD:239127 51/259 (20%)
Peptidase_C19 <427..>510 CDD:351799 14/84 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1867
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.