DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC6 and Hdac2

DIOPT Version :9

Sequence 1:NP_001259569.1 Gene:HDAC6 / 32461 FlyBaseID:FBgn0026428 Length:1179 Species:Drosophila melanogaster
Sequence 2:NP_445899.1 Gene:Hdac2 / 84577 RGDID:619976 Length:488 Species:Rattus norvegicus


Alignment Length:474 Identity:116/474 - (24%)
Similarity:197/474 - (41%) Gaps:57/474 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   533 KVCYAYDAQMLLHCNLNDTGHPEQPSRIQHIHKMHDDYGLLKQMKQLSPRAATTDEVCLAHTRAH 597
            ||||.||..:..:  ....|||.:|.||:..|.:..:|||.::|:...|..||.:|:...|:..:
  Rat    11 KVCYYYDGDIGNY--YYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEY 73

  Fly   598 VNTVRRLLGREPKELHDAAGIYNSVYLHPRTFD-----CATLAAGLVLQAVDSVLRGESRSGICN 657
            :..:|.:......|.......:|.....| .||     |.....|.|..||.  |..:......|
  Rat    74 IKFLRSIRPDNMSEYSKQMQRFNVGEDCP-VFDGLFEFCQLSTGGSVAGAVK--LNRQQTDMAVN 135

  Fly   658 VRPPGHHAEQDHPHGFCIFNNVAIAAQYAIRDFGLERVLIVDWDVHHGNGTQHIFESNPKVLYIS 722
            .....|||::....|||..|::.:|....::..  :|||.:|.|:|||:|.:..|.:..:|:.:|
  Rat   136 WAGGLHHAKKSEASGFCYVNDIVLAVLELLKYH--QRVLYIDIDIHHGDGVEEAFYTTDRVMTVS 198

  Fly   723 LHRYEHGSFFPKGPDGNFDVVGKGAGRGFNVNIPWNKKGMGDLEYALAFQQLIMPIAYEFNPQLV 787
            .|:|  |.:||  ..|:...:|.|.|:.:.||.|. :.|:.|..|...|:.:|..:...:.|..|
  Rat   199 FHKY--GEYFP--GTGDLRDIGAGKGKYYAVNFPM-RDGIDDESYGQIFKPIISKVMEMYQPSAV 258

  Fly   788 LVSAGFDAAIGDPLGGCKVTAEGYG-----MLTHWLSALASGRIIVCLEGGYNVNSISYAMTMCT 847
            ::..|.|:..||.||...:|.:|:.     :.|..|..|..|      .|||.:.:::...|..|
  Rat   259 VLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG------GGGYTIRNVARCWTYET 317

  Fly   848 KTLLGDPVPT------------PQLGATALQKPPTVAFQSCVESLQQCLQVQRNHWRSLEFVG-- 898
            ...|...:|.            |......  .|..:..|:..|.:::..|....:.|.|....  
  Rat   318 AVALDCEIPNELPYNDYFEYFGPDFKLHI--SPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGV 380

  Fly   899 --RRLPRDPVVGENNNED--------FLTASLRHLNISNDDATAAAGGLAGDRPDCGDERPSGSK 953
              :.:|.|.|..::.:||        .:.||.:.:....:.:.:...| .|.|.:..|.:....|
  Rat   381 QMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEG-EGGRRNVADHKKGAKK 444

  Fly   954 PKVK--VKTLSDYLAENKE 970
            .:::  .|...|...:.||
  Rat   445 ARIEEDKKEAEDKRTDVKE 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC6NP_001259569.1 HDAC10_HDAC6-dom1 119..457 CDD:212526
HDAC6-dom2 538..895 CDD:212527 95/378 (25%)
zf-UBP 1007..1069 CDD:280334
Hdac2NP_445899.1 PTZ00063 9..398 CDD:240251 103/406 (25%)
HDAC2 9..374 CDD:212535 99/382 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.